Dataset for protein Bcl-w of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H2Q805_BCL2L2-01      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
H2Q805_BCL2L2-02      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
H2Q805_BCL2L2-03      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
H2Q805_BCL2L2-04      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
                      **:.*:*. : . ...  .   *..  * ***  .***.....   .   

H2Q805_BCL2L2-01      AGDEFETRF----------------RRTFSDLAAQLHVTPGSAQQRFTQV
H2Q805_BCL2L2-02      AGDEFETRF----------------RRTFSDLAAQLHVTPGSAQQRFTQV
H2Q805_BCL2L2-03      ESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEE
H2Q805_BCL2L2-04      ESEELEPED------------------------------------QEEEE
                       .:*:*.                                      .  : 

H2Q805_BCL2L2-01      SDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLET
H2Q805_BCL2L2-02      SDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLET
H2Q805_BCL2L2-03      EPGLVEGDPGDGAI------------------------------------
H2Q805_BCL2L2-04      EPGLVEGDPGDGAI------------------------------------
                      .  *.:*.*. * :                                    

H2Q805_BCL2L2-01      RLADWIHSSGGWA-EFTALYGDGALEEARRLRE---------------GN
H2Q805_BCL2L2-02      RLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
H2Q805_BCL2L2-03      ---------EDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
H2Q805_BCL2L2-04      ---------EDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
                                .   *          *** .*.*               **

H2Q805_BCL2L2-01      WASV------------RTVLTGAVALGALVT-------------------
H2Q805_BCL2L2-02      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
H2Q805_BCL2L2-03      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
H2Q805_BCL2L2-04      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
                       ..*            *:: .* *  ** .                    

H2Q805_BCL2L2-01      --------------------------------------------------
H2Q805_BCL2L2-02      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIS
H2Q805_BCL2L2-03      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIS
H2Q805_BCL2L2-04      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIS
                                                                        

H2Q805_BCL2L2-01      -------------------------------------------VGAFFAS
H2Q805_BCL2L2-02      TTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSP
H2Q805_BCL2L2-03      TTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSP
H2Q805_BCL2L2-04      TTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSP
                                                                 . ::::.

H2Q805_BCL2L2-01      K
H2Q805_BCL2L2-02      Y
H2Q805_BCL2L2-03      Y
H2Q805_BCL2L2-04      Y
                       

© 1998-2022Legal notice