Dataset for protein Bcl-w of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
**:.*:*. : . ...  .   *..  * ***  .***.....   .    .:*:*.                       
  aa a aaaaaaaadfgggkg qkgl c   gea   aaadagdqamgaagd f peelllepepepepeeepp-----
                                                          d                 prap

        90       100       110       120       130       140       150       160
               .  : .  *.:*.*. * :                                              
---------------qeeeeede fe d gd aivaffvfgaalcaesvnkemeplvgqvqewmvayletrladwihsse
pg pgpgpgs apgs                                                                 

       170       180       190       200       210       220       230       240
.   *          *** .*.*               ** ..*            *:: .* *  ** .          
dpa- ftalygdgal   rr r ---------------  was ------------ tvlt a al  lvt---------

       250       260       270       280       290       300       310       320

       330       340       350 
                       . ::::. 
© 1998-2021Legal notice