Dataset for protein Mcl-1 of organism Ornithorhynchus anatinus

[Download (right click)] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A6I8NSR7_MCL1-01      MLGLQKNAVIGLNLYCGGAGSGAGASPPGGRLRPDKAAAVGEGPAAAAAA
A0A6I8NSR7_MCL1-02      MLGLQKNAVIGLNLYCGGAGSGAGASPPGGRLRPDKAAAVGEGPAAAAAA
                        **************************************************

A0A6I8NSR7_MCL1-01      AARRAGGGGEAAAPLIGGGAGASPSAAAGLGVARPAPIGAEGPDVIGTLA
A0A6I8NSR7_MCL1-02      AARRAGGGGEAAAPLIGGGAGASPSAAAGLGVARPAPIGAEGPDVIGTLA
                        **************************************************

A0A6I8NSR7_MCL1-01      PARRAPPEGTEPPPPSAAAAAAALLRPEDELDGYEPEAPAKRPAHLAVLD
A0A6I8NSR7_MCL1-02      PARRAPPEGTEPPPPSAAAAAAALLRPEDELDGYEPEAPAKRPAHLAVLD
                        **************************************************

A0A6I8NSR7_MCL1-01      LPGQAGGSLPSTPPPDDRDDMADGLYRQSLELITHYLREQAAGRKDEPRG
A0A6I8NSR7_MCL1-02      LPGQAGGSLPSTPPPDDRDDMADGLYRQSLELITHYLREQAAGRKDEPRG
                        **************************************************

A0A6I8NSR7_MCL1-01      RDRRALETLRRVGDGIQRNHETAFQGEGGLRRMREAGAPLPPPPSYVLSA
A0A6I8NSR7_MCL1-02      RDRRALETLRRVGDGIQRNHETAFQGM--LRKL-----------------
                        **************************   **::                 

A0A6I8NSR7_MCL1-01      LPEPNGTPPPPPVPSPRRHAPQAGHPEGGGPEGRVPRRHPRFQRRDDELG
A0A6I8NSR7_MCL1-02      ----------------------------------------DIQKEEDLKA
                                                                 :*:.:*  .

A0A6I8NSR7_MCL1-01      PHR-DAHLFRRLRGQALEEHQPGGLHRPPGREHHGGPGDHQEGLAGQTER
A0A6I8NSR7_MCL1-02      VSRVGTHVFN-----------------------------------DGTTN
                          * .:*:*.                                   . * .

A0A6I8NSR7_MCL1-01      LGRICGILPRGGHGRQRPERAPALRRGGQPGSRLGLSNKMMGGPPPPSPS
A0A6I8NSR7_MCL1-02      WGRIVTLISFGAFVAKHL------KSIN----------------------
                         ***  ::. *..  ::       :  .                      

A0A6I8NSR7_MCL1-01      DAQRLTSHRSRPAPGAGHPSELSLLPPGSFIYEAQRPAAQNWHRQAP---
A0A6I8NSR7_MCL1-02      -------------------QEGCIDPLAESITEVLVTTKRDWLVKQKGWE
                                           .* .: * .. * *.  .: ::*  :     

A0A6I8NSR7_MCL1-01      ----------------------SGGPARQEGLGWFGDGY
A0A6I8NSR7_MCL1-02      GFVEFFHVEDMEGSVRNVLLLFAGVASLGAGLAY--LIR
                                              :* .:   **.:     

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice