Dataset for protein Mcl-1 of organism Ornithorhynchus anatinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6I8NSR7_MCL1-02      MLGLQKNAVIGLNLYCGGAGSGAGASPPGGRLRPDKAAAVGEGPAAAAAA
A0A6I8NSR7_MCL1-01      MLGLQKNAVIGLNLYCGGAGSGAGASPPGGRLRPDKAAAVGEGPAAAAAA
                        **************************************************

A0A6I8NSR7_MCL1-02      AARRAGGGGEAAAPLIGGGAGASPSAAAGLGVARPAPIGAEGPDVIGTLA
A0A6I8NSR7_MCL1-01      AARRAGGGGEAAAPLIGGGAGASPSAAAGLGVARPAPIGAEGPDVIGTLA
                        **************************************************

A0A6I8NSR7_MCL1-02      PARRAPPEGTEPPPPSAAAAAAALLRPEDELDGYEPEAPAKRPAHLAVLD
A0A6I8NSR7_MCL1-01      PARRAPPEGTEPPPPSAAAAAAALLRPEDELDGYEPEAPAKRPAHLAVLD
                        **************************************************

A0A6I8NSR7_MCL1-02      LPGQAGGSLPSTPPPDDRDDMADGLYRQSLELITHYLREQAAGRKDEPRG
A0A6I8NSR7_MCL1-01      LPGQAGGSLPSTPPPDDRDDMADGLYRQSLELITHYLREQAAGRKDEPRG
                        **************************************************

A0A6I8NSR7_MCL1-02      RDRRALETLRRVGDGIQRNHETAFQGM--LRKL-----------------
A0A6I8NSR7_MCL1-01      RDRRALETLRRVGDGIQRNHETAFQGEGGLRRMREAGAPLPPPPSYVLSA
                        **************************   **.:                 

A0A6I8NSR7_MCL1-02      -----------------------------------------------DIQ
A0A6I8NSR7_MCL1-01      LPEPNGTPPPPPVPSPRRHAPQAGHPEGGGPEGRVPRRHPRFQRRDDELG
                                                                       :: 

A0A6I8NSR7_MCL1-02      KEEDLKAVSRVGTHVFND---------------------------GTTNW
A0A6I8NSR7_MCL1-01      PHRDAHLFRRLRGQALEEHQPGGLHRPPGREHHGGPGDHQEGLAGQTERL
                           * : . *:  :.:::                            * . 

A0A6I8NSR7_MCL1-02      GRIVTLISFGAF------VAKHLKSINQEGCI----------DPLAESIT
A0A6I8NSR7_MCL1-01      GRICGILPRGGHGRQRPERAPALRRGGQPGSRLGLSNKMMGGPPPPSPSD
                        ***  ::. *..       *  *.  .* *.            * ...  

A0A6I8NSR7_MCL1-02      EVLVTTKRDWLVKQKGWEGFVEFFHVEDM------------------EGS
A0A6I8NSR7_MCL1-01      AQRLTSHRSRPAPGAGHPSELSLLPPGSFIYEAQRPAAQNWHRQAPSGGP
                           :*::*.. .   *. . :.::   .:                   *.

A0A6I8NSR7_MCL1-02      VRNVLLLFAGVASLGAGLAYLIR
A0A6I8NSR7_MCL1-01      ARQ-----EGLGWFGDGY-----
                        .*:      *:. :* *      

© 1998-2020Legal notice