Dataset for protein Mcl-1 of organism Ornithorhynchus anatinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160

       170       180       190       200       210       220       230       240
******************************************************************   **.:       
                                                                  egg  klreagapl

       250       260       270       280       290       300       310       320
                                                         ::    * : . *:  :.:::  
ppppsyvlsalpepngtpppppvpsprrhapqaghpegggpegrvprrhprfqrrdddigkee ahafr lgghafedhq

       330       340       350       360       370       380       390       400
                          * . ***  ::. *..       *  *.  .* *.            * ...  
pgglhrppgrehhggpgdhqeglagg enl   cgiipf afgrqrper ka krgg e cilglsnkmmggd laepid

       410       420       430       440       450       460       470   
   :*::*.. .   *. . :.::   .:                   *..*:      *:. :* *      
aqll sh drlakga hegeleffhpedfiyeaqrpaaqnwhrqapse pa nvlllfa lasf a laylir
© 1998-2021Legal notice