Dataset for protein Bcl-2 of organism Oreochromis aureus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A668TEB6_BCL2-02      MSSEEGFSSAITDWLFINTWWLLLPFIMLLVVAAFIVAFVLL----LYMI
A0A668TEB6_BCL2-01      ---------------------------MLLVVAAFIVAFVLL----LYMI
A0A668TEB6_BCL2-03      ---------------------------MLLVVAAFIVAFVLL----LYMI
A0A668TEB6_BCL2-05      --MANEYNRNIVEKYICHK----------LSKRGYVWGFRVVQEEDAANN
A0A668TEB6_BCL2-04      MSSEEGFSSAITDWLFINTWWLLLPFIMLLVVAAFIVAFVLL----LYMI
                                                     *   .:: .* ::        

A0A668TEB6_BCL2-02      SPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEEKL
A0A668TEB6_BCL2-01      SPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEEKL
A0A668TEB6_BCL2-03      SPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEEKL
A0A668TEB6_BCL2-05      GSITDPPPTLVHRCREASTGPD---------------------GESN---
A0A668TEB6_BCL2-04      SPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDE---
                        ..: .* *  :: .. . ** .                     . .:   

A0A668TEB6_BCL2-02      LQAKKEVEKFAINDKQVVLCISVDVSSDYSQVENVIKQAQEKLG------
A0A668TEB6_BCL2-01      LQAKKEVEKFAINDKQVVLCISVDVSSDYSQVENVIKQAQEKLG------
A0A668TEB6_BCL2-03      LQAKKEVEKFAINDKQVVLCISVDVSSDYSQVENVIKQAQEKLG------
A0A668TEB6_BCL2-05      ----------------THLCRRLPQSDPHAGIHRVLREAGDELERLYQPD
A0A668TEB6_BCL2-04      ----------------VVLCISVDVSSDYSQVENVIKQAQEKLG------
                                        . **  :  *. :: : .*:.:* ::*       

A0A668TEB6_BCL2-02      --PVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTMK
A0A668TEB6_BCL2-01      --PVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTMK
A0A668TEB6_BCL2-03      --PVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTMK
A0A668TEB6_BCL2-05      FTEMSRQLHLTSATAQRRFAEVIDELFR----------------------
A0A668TEB6_BCL2-04      --PVDMLVNCAGTSVSGKFEEVEVDRFKI---------------------
                           :.  :: :.::.. .* **  : *.                      

A0A668TEB6_BCL2-02      ERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYV
A0A668TEB6_BCL2-01      ERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYV
A0A668TEB6_BCL2-03      ERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYV
A0A668TEB6_BCL2-05      --------------------------------------------------
A0A668TEB6_BCL2-04      --------------------------------------------------
                                                                          

A0A668TEB6_BCL2-02      TVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIVRDAVQG
A0A668TEB6_BCL2-01      TVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIVRDAVQG
A0A668TEB6_BCL2-03      TVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIVRDAI--
A0A668TEB6_BCL2-05      --------------------------------------------------
A0A668TEB6_BCL2-04      --------------------------------------------------
                                                                          

A0A668TEB6_BCL2-02      NFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFR----------
A0A668TEB6_BCL2-01      NFNSSVGPDGYMLSALTCGMSPVTSITEGLQQDAFVELYDRQRDSVFSCS
A0A668TEB6_BCL2-03      -------------------------VTMGLFR------------------
A0A668TEB6_BCL2-05      -------------------------DGVNWGR------------------
A0A668TEB6_BCL2-04      -------------------------VTMGLFR------------------
                                                    .  .                  

A0A668TEB6_BCL2-02      ------TIALFYL-------------------------------------
A0A668TEB6_BCL2-01      WPSIKTVFGLAAL-------------------------------------
A0A668TEB6_BCL2-03      ------TIALFYL-------------------------------------
A0A668TEB6_BCL2-05      ------IIAFFEFGGTVCVECASNEGMSSQVDNIADWMTEYLNGPLNSWI
A0A668TEB6_BCL2-04      ------TIALFYL-------------------------------------
                               :.:  :                                     

A0A668TEB6_BCL2-02      ---GSFDSIVRRCMIQREQSKAANKRE-----------------------
A0A668TEB6_BCL2-01      ---GAASLTIGAYLTQK---------------------------------
A0A668TEB6_BCL2-03      ---GSFDSIVRRCMIQREQSKAANKRE-----------------------
A0A668TEB6_BCL2-05      QDNGGWDAFVELYDRQRDSVFSCSWPSIKTVFGLAALGAASLTIGAYLTQ
A0A668TEB6_BCL2-04      ---GSFDSIVRRCMIQREQSKAANKRE-----------------------
                           *. .  :     *.                                 

A0A668TEB6_BCL2-02      -
A0A668TEB6_BCL2-01      -
A0A668TEB6_BCL2-03      -
A0A668TEB6_BCL2-05      K
A0A668TEB6_BCL2-04      -
                         

© 1998-2020Legal notice