Dataset for protein Bcl-2 of organism Oreochromis aureus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             *   .:: .* ::        ..: .* *  :: .. . ** .        
----------i----------------mlLvvaafivaFvll----lymisplisPkPlklngahvvvTGgssgigkcia
msseegfssa-tdwlfintwwlllpfi-- skrgyvwg rvvqeedaanngsitd p tlvhrcreas  pd--------
  maneynrn vekyichk                                                             

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             . .:                   . **  :  *. :: : .*:.:* ::*          :.  :: 
iecykqgafitlvardeekllqakkevekfaindkqvvLCisvdvSsdysqvenVikqAqekLg--------pvdmlvnc
-------------gesn-------------------th  rrlpq dphagihr lre gde erlyqpdftemsrqlhl
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:.::.. .* **  : *.                                                              
agtsvsgkFeEVevdrFkklmevnylgsvyptravittmkerrmgrimfvssqagqiglfgytayspskfalrglaeslq
tsataqrr a  idel r--------------------------------------------------------------
                  i                                                             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
meikpyniyvtvayppdtdtpglaeenktkpletklisetsgvcqpdqvakiivrda-----------------------
---------------------------------------------------------vqgnfnssvgpdgymlsaltcgm
                                                         i                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        .  .                         :.:  :                                     
-----vtmglqr------------------------tialfyl-------------------------------------
spvtsigenwfqivtvglyrrqrdsvfscswpsiktvfgfaefggtvcvecasnegmssqvdniadwmteylngplnswi
     d v  g dafme fd                i    a                                      

       410       420       430       440       450 
....:....|....:....|....:....|....:....|....:....|.
   *. .  :     *.                                  
---GsfdsivrrcmiQreqskaankre------------------------
qdn gwsltiglylt k----------iktvfglaalgaasltigayltqk
    aa af ea dr  dsvfscswps                        
© 1998-2020Legal notice