Dataset for protein Mcl-1 of organism Oncorhynchus mykiss

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7PM33_MCL1-03      MSLSKSITRATTTMLNFQNGVVGGSSYPAGTSLYYFGETGAVRAGASPKS
A0A8C7PM33_MCL1-02      MSLSKSITRATTTMLNFQNGVVGGSSYPAGTSLYYFGETGAVRAGASPKS
A0A8C7PM33_MCL1-01      MSLSKSITRATTTMLNFQNGVVGGSSYPAGTSLYYFGETGAVRAGASPKS
                        **************************************************

A0A8C7PM33_MCL1-03      KVDTDLGNGTGDTPPRPTKLGVNVVKSNVLGNHLSDRSNNDDSDGSLPCT
A0A8C7PM33_MCL1-02      KVDTDLGNGTGDTPPRPTKLGVNVVKSNVLGNHLSDRSNNDDSDGSLPCT
A0A8C7PM33_MCL1-01      KVDTDLGNGTGDTPPRPTKLGVNVVKSNVLGNHLSDRSNNDDSDGSLPCT
                        **************************************************

A0A8C7PM33_MCL1-03      PQVASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLSPSRCKQSKAL
A0A8C7PM33_MCL1-02      PQVASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLSPSRCKQSKAL
A0A8C7PM33_MCL1-01      PQVASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLSPSRCKQSKAL
                        **************************************************

A0A8C7PM33_MCL1-03      TTMKKVVKDIIAKHRYAYNGMIAKLDLDDRCDDMSFINSVATTMFSDGTT
A0A8C7PM33_MCL1-02      TTMKKVVKDIIAKHRYAYNGMIAKLDLDDRCDDMSFINSVATTMFSDGTT
A0A8C7PM33_MCL1-01      TTMKKVVKDIIAKHRYAYNGMIAKLDLDDRCDDMSFINSVATTMFSDGTT
                        **************************************************

A0A8C7PM33_MCL1-03      NWGRIASLVAFGAVVSQHLKEMGRGHCIESVGQKIATYLLSDQRDWLVKN
A0A8C7PM33_MCL1-02      NWGRIASLVAFGAVVSQHLKEMGRGHCIESVGQKIATYLLSDQRDWLVKN
A0A8C7PM33_MCL1-01      NWGRIASLVAFGAVVSQHLKEMGRGHCIESVGQKIATYLLSDQRDWLVKN
                        **************************************************

A0A8C7PM33_MCL1-03      NAWNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLVSLLDYSGGLN
A0A8C7PM33_MCL1-02      NAWNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLVR---------
A0A8C7PM33_MCL1-01      NAWNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLVRNSED-----
                        ****************************************          

A0A8C7PM33_MCL1-03      WDSALVSSSS
A0A8C7PM33_MCL1-02      ----------
A0A8C7PM33_MCL1-01      ----------
                                  

© 1998-2022Legal notice