Dataset for protein Mcl-1 of organism Oncorhynchus mykiss

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8K9V051_MCL1-01      MACPDIGNRVKATLKHLKVAGSIDSTPLFTSRGPEHEYRWGDLETDSSLA
A0A8C7LPD4_MCL1-01      MSLSKSIARATTTM--LHFQN---GGSSYLADDASPLYYFD---------
A0A8C7PM33_MCL1-03      MSLSKSITRATTTM--LNFQNGVVGGSSYPA--GTSLYYFGET-------
A0A8C7PM33_MCL1-01      MSLSKSITRATTTM--LNFQNGVVGGSSYPA--GTSLYYFGET-------
A0A8C7PM33_MCL1-02      MSLSKSITRATTTM--LNFQNGVVGGSSYPA--GTSLYYFGET-------
                        *: ..   *..:*:  *:. .   . . : :      * :.         

A0A8K9V051_MCL1-01      YGSKHFGVLGESANMYHLPNTVDTHKCFMCNLEIKNFVENDTLLGEHIFH
A0A8C7LPD4_MCL1-01      -GAVCAAASPKSKV--DLGNGTGDTPPRPTTLGVN--VVKSNVLDNH---
A0A8C7PM33_MCL1-03      -GAVRAGASPKSKVDTDLGNGTGDTPPRPTKLGVN--VVKSNVLGNH---
A0A8C7PM33_MCL1-01      -GAVRAGASPKSKVDTDLGNGTGDTPPRPTKLGVN--VVKSNVLGNH---
A0A8C7PM33_MCL1-02      -GAVRAGASPKSKVDTDLGNGTGDTPPRPTKLGVN--VVKSNVLGNH---
                         *:   ..  :*     * * ..       .* ::  * :..:*.:*   

A0A8K9V051_MCL1-01      VYNTSGRCKYLTDRYTNREDEMMLLLGKERYRRGKIAFPDSIITNSTGAL
A0A8C7LPD4_MCL1-01      ----------LSDRSNNDD---SLPCTPQMASECGPELSNC--PSGDEVL
A0A8C7PM33_MCL1-03      ----------LSDRSNNDDSDGSLPCTPQVASECGPELSNC--QSGDEVL
A0A8C7PM33_MCL1-01      ----------LSDRSNNDDSDGSLPCTPQVASECGPELSNC--QSGDEVL
A0A8C7PM33_MCL1-02      ----------LSDRSNNDDSDGSLPCTPQVASECGPELSNC--QSGDEVL
                                  *:** .* :    *    :        :.:.   ..  .*

A0A8K9V051_MCL1-01      DTDTRQLIKCVLGQCTGLLKPRWNESKALSTMSRVIGQLLEKHRYTYNGM
A0A8C7LPD4_MCL1-01      EHDIRQLIENFLGDYTGLSQPRWKQSKPLTTMKRVVEDVIAKHRYAYKGM
A0A8C7PM33_MCL1-03      EHDTRQLIENVLVDYTGLSPSRCKQSKALTTMKKVVKDIIAKHRYAYNGM
A0A8C7PM33_MCL1-01      EHDTRQLIENVLVDYTGLSPSRCKQSKALTTMKKVVKDIIAKHRYAYNGM
A0A8C7PM33_MCL1-02      EHDTRQLIENVLVDYTGLSPSRCKQSKALTTMKKVVKDIIAKHRYAYNGM
                        : * ****: .* : ***  .* ::**.*:**..*: ::: ****:*:**

A0A8K9V051_MCL1-01      INTLYVDDRGDNVKFLSAVAHSIFEDGTVNWGRVASLTSFGAAVCRYLRG
A0A8C7LPD4_MCL1-01      VVKLDLDDRCDDMSVVNSVAKTMFSDGITNWGRIASLVAFGAVVSQHLKE
A0A8C7PM33_MCL1-03      IAKLDLDDRCDDMSFINSVATTMFSDGTTNWGRIASLVAFGAVVSQHLKE
A0A8C7PM33_MCL1-01      IAKLDLDDRCDDMSFINSVATTMFSDGTTNWGRIASLVAFGAVVSQHLKE
A0A8C7PM33_MCL1-02      IAKLDLDDRCDDMSFINSVATTMFSDGTTNWGRIASLVAFGAVVSQHLKE
                        : .* :*** *::..:.:** ::*.** .****:***.:***.*..:*. 

A0A8K9V051_MCL1-01      KGRDNCVDLVGEEISEYLVTHHKDWLVKHNSWNGFVEFFPVAEPESRCRN
A0A8C7LPD4_MCL1-01      SGRGHCVDLVGQEIATYLLSDQRDWLVKNNAWDGFVEFFHVQDPESSKMD
A0A8C7PM33_MCL1-03      MGRGHCIESVGQKIATYLLSDQRDWLVKNNAWNGFVEFFHVQDPESSVRN
A0A8C7PM33_MCL1-01      MGRGHCIESVGQKIATYLLSDQRDWLVKNNAWNGFVEFFHVQDPESSVRN
A0A8C7PM33_MCL1-02      MGRGHCIESVGQKIATYLLSDQRDWLVKNNAWNGFVEFFHVQDPESSVRN
                         **.:*:: **::*: **:: :.*****:*:*:****** * :***   :

A0A8K9V051_MCL1-01      IIMTIFGLAGIGATMTFLVM-------------------
A0A8C7LPD4_MCL1-01      YARKFSEI--LDSTMVGMSTQ------------------
A0A8C7PM33_MCL1-03      TLIAFAGFAGLGATLAMLVSLLDYSGGLNWDSALVSSSS
A0A8C7PM33_MCL1-01      TLIAFAGFAGLGATLAMLVRNSED---------------
A0A8C7PM33_MCL1-02      TLIAFAGFAGLGATLAMLVR-------------------
                            :  :  :.:*:. :                     

© 1998-2023Legal notice