Dataset for protein Mcl-1 of organism Oncorhynchus mykiss

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C7LPD4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus mykiss GN=MCL-1 (length=282 residues).
MSLSKSIARATTTMLHFQNGGSSYLADDASPLYYFDGAVCAAASPKSKVDLGNGTGDTPPRPTTLGVNVVKSNVLDNHLS
DRSNNDDSLPCTPQMASECGPELSNCPSGDEVLEHDIRQLIENFLGDYTGLSQPRWKQSKPLTTMKRVVEDVIAKHRYAY
KGMVVKLDLDDRCDDMSVVNSVAKTMFSDGITNWGRIASLVAFGAVVSQHLKESGRGHCVDLVGQEIATYLLSDQRDWLV
KNNAWDGFVEFFHVQDPESSKMDYARKFSEILDSTMVGMSTQ
>gnl|bcl2dbpro|A0A8C7PM33_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus mykiss GN=MCL-1 (length=291 residues).
MSLSKSITRATTTMLNFQNGVVGGSSYPAGTSLYYFGETGAVRAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVL
GNHLSDRSNNDDSDGSLPCTPQVASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLSPSRCKQSKALTTMKKVVKDI
IAKHRYAYNGMIAKLDLDDRCDDMSFINSVATTMFSDGTTNWGRIASLVAFGAVVSQHLKEMGRGHCIESVGQKIATYLL
SDQRDWLVKNNAWNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLVR
>gnl|bcl2dbpro|A0A8C7PM33_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus mykiss GN=MCL-1 (length=295 residues).
MSLSKSITRATTTMLNFQNGVVGGSSYPAGTSLYYFGETGAVRAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVL
GNHLSDRSNNDDSDGSLPCTPQVASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLSPSRCKQSKALTTMKKVVKDI
IAKHRYAYNGMIAKLDLDDRCDDMSFINSVATTMFSDGTTNWGRIASLVAFGAVVSQHLKEMGRGHCIESVGQKIATYLL
SDQRDWLVKNNAWNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLVRNSED
>gnl|bcl2dbpro|A0A8C7PM33_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus mykiss GN=MCL-1 (length=310 residues).
MSLSKSITRATTTMLNFQNGVVGGSSYPAGTSLYYFGETGAVRAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVL
GNHLSDRSNNDDSDGSLPCTPQVASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLSPSRCKQSKALTTMKKVVKDI
IAKHRYAYNGMIAKLDLDDRCDDMSFINSVATTMFSDGTTNWGRIASLVAFGAVVSQHLKEMGRGHCIESVGQKIATYLL
SDQRDWLVKNNAWNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLVSLLDYSGGLNWDSALVSSSS
>gnl|bcl2dbpro|A0A8K9V051_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus mykiss GN=MCL-1 (length=320 residues).
MACPDIGNRVKATLKHLKVAGSIDSTPLFTSRGPEHEYRWGDLETDSSLAYGSKHFGVLGESANMYHLPNTVDTHKCFMC
NLEIKNFVENDTLLGEHIFHVYNTSGRCKYLTDRYTNREDEMMLLLGKERYRRGKIAFPDSIITNSTGALDTDTRQLIKC
VLGQCTGLLKPRWNESKALSTMSRVIGQLLEKHRYTYNGMINTLYVDDRGDNVKFLSAVAHSIFEDGTVNWGRVASLTSF
GAAVCRYLRGKGRDNCVDLVGEEISEYLVTHHKDWLVKHNSWNGFVEFFPVAEPESRCRNIIMTIFGLAGIGATMTFLVM
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice