Dataset for protein Bcl-xL of organism Oncorhynchus mykiss

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A060XE41_BCL2L1-      MHKNGIYLLKNRYLFIERYLSLICNYLGLAVQYFKGMITCCSPEETARQQ
A0A060XE41_BCL2L1-      ------MSYSNRELVV----------------------------------
A0A286MU87_BCL2L1-      ------MSYSNRELVV----------------------------------
                                 .** *.:                                  

A0A060XE41_BCL2L1-      AFIPDISVSVSYRLSQRNYSCCQLGLEGASGRTDGDEAIANGSVGNYRNS
A0A060XE41_BCL2L1-      -------FFISYRLSQRNYSCCQLGLEGASGRTDGDEAIANGSVGNYRNS
A0A286MU87_BCL2L1-      -------FFISYRLSQRNYSCCQLGLEGASGRTDGDEAIANGSVGNYRNS
                               . :****************************************

A0A060XE41_BCL2L1-      RSNLAKPSSPQGGMEPVKAALRDSVDEFELRYTRAFSDLSSQLHITPATA
A0A060XE41_BCL2L1-      RSNLAKPSSPQGGMEPVKAALRDSVDEFELRYTRAFSDLSSQLHITPATA
A0A286MU87_BCL2L1-      RSNLAKPSSPQGGMEPVKAALRDSVDEFELRYTRAFSDLSSQLHITPATA
                        **************************************************

A0A060XE41_BCL2L1-      YHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADW
A0A060XE41_BCL2L1-      YHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADW
A0A286MU87_BCL2L1-      YHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADW
                        **************************************************

A0A060XE41_BCL2L1-      MTTYLDNHIQPWIQSQGGWDRFAEIFGRDAAADVRRSQESIIKWLLVGVI
A0A060XE41_BCL2L1-      MTTYLDNHIQPWIQSQGGWDRFAEIFGRDAAADVRRSQESIIKWLLVGVI
A0A286MU87_BCL2L1-      MTTYLDNHIQPWIQSQGGW---AEIFGRDAAADVRRSQESIIKWLLVGVI
                        *******************   ****************************

A0A060XE41_BCL2L1-      LLSGVLVGTLIMKKRQ
A0A060XE41_BCL2L1-      LLSGVLVGTLIMKKRQ
A0A286MU87_BCL2L1-      LLSGVLVGTLIMKKRQ
                        ****************

© 1998-2020Legal notice