Dataset for protein Bcl-xL of organism Oncorhynchus mykiss

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .** *.:                                         . :********************
------msysNReLvv-----------------------------------------ffiSYRLSQRNYSCCQLGLEGAS
mhkngiyllk  y fierylslicnylglavqyfkgmitccspeetarqqafipdisvsv                    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
GRTDGDEAIANGSVGNYRNSRSNLAKPSSPQGGMEPVKAALRDSVDEFELRYTRAFSDLSSQLHITPATAYHSFESVMDE
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***********************************************************   ******************
VFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDNHIQPWIQSQGGWdrfAEIFGRDAAADVRRSQES
                                                           ---                  

       250       260      
....:....|....:....|....:.
**************************
IIKWLLVGVILLSGVLVGTLIMKKRQ
                          
© 1998-2020Legal notice