Dataset for protein BCL-2-like of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3GEA7_BCL2L2-      --MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRA
A0A2I3GEA7_BCL2L2-      GLRAVRGSGPGRRR--------HLVPRGRWGGRGGGPRGPEELLLEPEPE
A0A2I3GB35_MCL1-02      --------MFGLRRNAVIGLNLYCGGAGLGAGSGGATPPGGRLL------
A0A2I3GB35_MCL1-01      --------MFGLRRNAVIGLNLYCGGAGLGAGSGGATPPGGRLL------
A0A2I3GB35_MCL1-03      -------MFGLRRNAVIGLNLY----------------------------
A0A2I3GZF9_BCL2-01      -MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIF
G1R3W6_BCL2L10-01       ---MVDQLRERTERLLADYL---------------------------GCC
A0A2I3GQS0_BCL2A1-      ---MTDCEFGYIYRLAQDYLQYVLQIP-----------------------
A0A2I3GQS0_BCL2A1-      ---MTDCEFGYIYRLAQDYLQYVLQIP-----------------------
A0A2I3GQS0_BCL2A1-      ---MTDCEFGYIYRLAQDYLQYVLQIP-----------------------
A0A2I3GEA7_BCL2L2-      --MATPASAPDTRALVADFVGYKLRQKGY---------------------
G1RER8_BCL2L1-01        -------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTES
                                                                          

A0A2I3GEA7_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQGGPNWGRL
A0A2I3GEA7_BCL2L2-      PEPEEEPPRPRAPPGAPGP---GPGSGAPGSQEEEEEPGLVEGDPGDGAI
A0A2I3GB35_MCL1-02      -ATEKEASARREIGGGEAGAVIGGSAGASPPSVLTPDSRRVARPPPIGAE
A0A2I3GB35_MCL1-01      -ATEKEASARREIGGGEAGAVIGGSAGASPPSVLTPDSRRVARPPPIGAE
A0A2I3GB35_MCL1-03      --------------------CGGAGLGAGSGGMLR---------------
A0A2I3GZF9_BCL2-01      SSQPGHTPHPAASRDPVARTSPLPTPAAPGAAAGPAL-------------
G1R3W6_BCL2L10-01       AREPG---------------TPEPTPSTPEAAMLRSA-------------
A0A2I3GQS0_BCL2A1-      ------------------------QPGSGPSKTSR---------------
A0A2I3GQS0_BCL2A1-      ------------------------QPGSGPSKTSR---------------
A0A2I3GQS0_BCL2A1-      ------------------------QPGSGPSKTSR---------------
A0A2I3GEA7_BCL2L2-      --------------------VCGAGPGEGPAAD-----------------
G1RER8_BCL2L1-01        EMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV-------------
                                                  .                       

A0A2I3GEA7_BCL2L2-      VAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWEL
A0A2I3GEA7_BCL2L2-      ---------------------------------------------EDPEL
A0A2I3GB35_MCL1-02      -------------------------------------VSDVTATPARLLF
A0A2I3GB35_MCL1-01      -------------------------------------VSDVTATPARLLF
A0A2I3GB35_MCL1-03      --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2I3GQS0_BCL2A1-      --------------------------------------------------
A0A2I3GQS0_BCL2A1-      --------------------------------------------------
A0A2I3GQS0_BCL2A1-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
                                                                          

A0A2I3GEA7_BCL2L2-      EAIKARVREMEE-EAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKME
A0A2I3GEA7_BCL2L2-      EAIKARVREMEE-EAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKME
A0A2I3GB35_MCL1-02      FAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVG
A0A2I3GB35_MCL1-01      FAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVG
A0A2I3GB35_MCL1-03      --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2I3GQS0_BCL2A1-      --------------------------------------------------
A0A2I3GQS0_BCL2A1-      --------------------------------------------------
A0A2I3GQS0_BCL2A1-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
                                                                          

A0A2I3GEA7_BCL2L2-      ADARSIYVGNV--DYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFA
A0A2I3GEA7_BCL2L2-      ADARSIYVGNV--DYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFA
A0A2I3GB35_MCL1-02      ESGNNTSTDGSLPSTPPPAEEEEDELYR----QSLEIISRYLREQATGAK
A0A2I3GB35_MCL1-01      ESGNNTSTDGSLPSTPPPAEEEEDELYR----QSLEIISRYLREQATGAK
A0A2I3GB35_MCL1-03      --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2I3GQS0_BCL2A1-      --------------------------------------------------
A0A2I3GQS0_BCL2A1-      --------------------------------------------------
A0A2I3GQS0_BCL2A1-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
                                                                          

A0A2I3GEA7_BCL2L2-      YIEFSDKESVRTSLALD-------------ESLFRGRQIKV------IPK
A0A2I3GEA7_BCL2L2-      YIEFSDKESVRTSLALD-------------ESLFRGRQIKV------IPK
A0A2I3GB35_MCL1-02      DTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVK
A0A2I3GB35_MCL1-01      DTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV---------
A0A2I3GB35_MCL1-03      ---------------------------------------KLDIKNEDDVK
A0A2I3GZF9_BCL2-01      --------SPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARG
G1R3W6_BCL2L10-01       --------AA-------RLRQLHPSFFSAY---LGYPGNRVELVVLMADS
A0A2I3GQS0_BCL2A1-      -------------VLQNVAFSVQKEVEKNLKPCLDNVNV---VSIDTART
A0A2I3GQS0_BCL2A1-      -------------VLQNVAFSVQKEVEKNLKPCLDNVNV---VSIDTART
A0A2I3GQS0_BCL2A1-      -------------VLQNVAFSVQKEVEKNLKPCLDNVNV---VSIDTART
A0A2I3GEA7_BCL2L2-      -------------PLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
G1RER8_BCL2L1-01        --------IP-MAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQ
                                                                          

A0A2I3GEA7_BCL2L2-      RTNRPGISTTDRGFPRARYRARTTNYNSSRS------------------R
A0A2I3GEA7_BCL2L2-      RTNRPGISTTDRGFPRARYRARTTNYNSSRS------------------R
A0A2I3GB35_MCL1-02      SLSRVMVHVFSDGVTNWGRIVTLISFGAFVA------------------K
A0A2I3GB35_MCL1-01      --------LPCRGPRRW---------------------------------
A0A2I3GB35_MCL1-03      SLSRVMVHVFSDGVTNWGRIVTLISFGAFVA------------------K
A0A2I3GZF9_BCL2-01      RFATVVEELFRDG-VNWGRIVAFFEFGGVMC------------------V
G1R3W6_BCL2L10-01       VLSD------SPG-PTWGRVVTLVAFAGTLLERGPLVTARWKKWGFQPRL
A0A2I3GQS0_BCL2A1-      LFNQVMEKEFEDGIINWGRIVTIFAFEGILV------------------K
A0A2I3GQS0_BCL2A1-      LFNQVMEKEFEDGIINWGRIVTIFAFEGILV------------------K
A0A2I3GQS0_BCL2A1-      LFNQVMEKEFEDGIINWGRIVTIFAFEGILV------------------K
A0A2I3GEA7_BCL2L2-      RFTQVSDELFQGG-PNWGRLVAFFVFGAALC------------------A
G1RER8_BCL2L1-01        SFEQVVNELFRDG-VNWGRIVAFFSFGGALC------------------V
                                    *                                     

A0A2I3GEA7_BCL2L2-      FYSGFNSRPRGR---VYRGRARA------TSWYSPY--------------
A0A2I3GEA7_BCL2L2-      FYSGFNSRPRGR---VYRGRARA------TSWYSPY--------------
A0A2I3GB35_MCL1-02      HLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGWDG---------
A0A2I3GB35_MCL1-01      ------HQKCAA---GFCRCCWS------RSWF-----------------
A0A2I3GB35_MCL1-03      HLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGWDG---------
A0A2I3GZF9_BCL2-01      ESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGWDA---------
G1R3W6_BCL2L10-01       KEQEGDVARDCQ---RLVALLSSRLVGQHRAWLQAQGGWVSTRRTPGHGA
A0A2I3GQS0_BCL2A1-      KLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWEN---------
A0A2I3GQS0_BCL2A1-      KLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGK---------
A0A2I3GQS0_BCL2A1-      KLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWEN---------
A0A2I3GEA7_BCL2L2-      ESVNKEMEPLVG---QVQEWMVAYLETRLADWIHSSGGWAE---------
G1RER8_BCL2L1-01        ESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGWDT---------
                                                       *                  

A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2I3GB35_MCL1-02      --------------FVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A2I3GB35_MCL1-01      ---------------------------------------GISNKIALL--
A0A2I3GB35_MCL1-03      --------------FVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A2I3GZF9_BCL2-01      --------------FVELYGPSMRPLF-------DFSWLSLKTLLSLALV
G1R3W6_BCL2L10-01       GRAAGKRPRGRHGWLLSLLQDPLSAGFLEKTAGPGFSVMLVNNSLHLFLD
A0A2I3GQS0_BCL2A1-      GFVKKFEPKSGWMTFLEVTGKISILLTRKDTPYCETGLIFLTLMETIANT
A0A2I3GQS0_BCL2A1-      -----------WHNHMPM---LVESVAHKKRKMAL---------------
A0A2I3GQS0_BCL2A1-      GFVKKFEPKSGWMTFLEVTGKICEMLSFLKQYC-----------------
A0A2I3GEA7_BCL2L2-      --------------FTALYGDGALEEARRLREGNWASVRTVLTGAVALGA
G1RER8_BCL2L1-01        --------------FVELYGNNAAAESRKGQE------------------
                                                                          

A0A2I3GEA7_BCL2L2-      -----------------
A0A2I3GEA7_BCL2L2-      -----------------
A0A2I3GB35_MCL1-02      -----------------
A0A2I3GB35_MCL1-01      -----------------
A0A2I3GB35_MCL1-03      -----------------
A0A2I3GZF9_BCL2-01      GACITLGAYLGHK----
G1R3W6_BCL2L10-01       TIIMSFKTFNPLLPAQL
A0A2I3GQS0_BCL2A1-      YFYFKINNFDDVT----
A0A2I3GQS0_BCL2A1-      -----------------
A0A2I3GQS0_BCL2A1-      -----------------
A0A2I3GEA7_BCL2L2-      LVTVGAFFASK------
G1RER8_BCL2L1-01        --RFNRWFLTG------
                                         

© 1998-2021Legal notice