Dataset for protein BCL-2-like of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3GEA7_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKG------Y----------------
A0A2I3GJZ3_MCL1-01      -------------------MFGLRRNAVIGLNLY----------------
A0A2I3GJZ3_MCL1-02      -------------------MFGLRRNAVIGLNLY----------------
A0A2I3GZF9_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFS
G1R3W6_BCL2L10-01       --MVDQLRERTERLLADYL---------------------------GCCA
A0A2I3HBP6_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIP------------------------
A0A2I3HBP6_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIP------------------------
A0A2I3GEA7_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGY----------------------
G1RER8_BCL2L1-01        ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
                                                                          

A0A2I3GEA7_BCL2L2-      -------------------VCGAGPGEGP-AAD--------PLHQAMRAA
A0A2I3GJZ3_MCL1-01      -------------------CGGAGLGAGSGGAT--------PPGGRLLAT
A0A2I3GJZ3_MCL1-02      -------------------CGGAGLGAGSGGAT--------PPGGRLLAT
A0A2I3GZF9_BCL2-01      SQPGHTPHPAASRDPVARTSPLPTPAAPGAAAGPALSPVPPVVHLTLRQA
G1R3W6_BCL2L10-01       REPG---------------TPEPTPSTPEAAMLRSAAA-------RLRQL
A0A2I3HBP6_BCL2A1-      -----------------------QPGSGPSKTSR-------VLQNVAFSV
A0A2I3HBP6_BCL2A1-      -----------------------QPGSGPSKTSR-------VLQNVAFSV
A0A2I3GEA7_BCL2L2-      -------------------VCGAGPGEGPAAD---------PLHQAMRAA
G1RER8_BCL2L1-01        METPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIP-MAAVKQALREA
                                                 .                        

A0A2I3GEA7_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVA
A0A2I3GJZ3_MCL1-01      EKEASARREIGGGEAGAVIGGSAGASPPSVLTPDSRRVARP-PPIGAEVS
A0A2I3GJZ3_MCL1-02      EKEASARREIGGGEAGAVIGGSAGASPPSVLTPDSRRVARP-PPIGAEVS
A0A2I3GZF9_BCL2-01      GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDG-VNWGRIVA
G1R3W6_BCL2L10-01       HPSFFSAY---LGYPGNRVELVVLMADSVLSD------SPG-PTWGRVVT
A0A2I3HBP6_BCL2A1-      QKEVEKNLKPCLDNVNV---VSIDTARTLFNQVMEKEFEDGIINWGRIVT
A0A2I3HBP6_BCL2A1-      QKEVEKNLKPCLDNVNV---VSIDTARTLFNQVMEKEFEDGIINWGRIVT
A0A2I3GEA7_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVA
G1RER8_BCL2L1-01        GDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDG-VNWGRIVA
                          .                      :   .               *  *:

A0A2I3GEA7_BCL2L2-      --------FFVFGAALC------------------AESVNKEMEPLVG--
A0A2I3GJZ3_MCL1-01      DVTATPARLLFFAPTRR------------------AAPLEE---------
A0A2I3GJZ3_MCL1-02      DVTATPARLLFFAPTRR------------------AAPLEE---------
A0A2I3GZF9_BCL2-01      --------FFEFGGVMC------------------VESVNREMSPLVD--
G1R3W6_BCL2L10-01       --------LVAFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQ--
A0A2I3HBP6_BCL2A1-      --------IFAFEGILV------------------KKLLRQRTAPDVDTY
A0A2I3HBP6_BCL2A1-      --------IFAFEGILV------------------KKLLRQRTAPDVDTY
A0A2I3GEA7_BCL2L2-      --------FFVFGAALC------------------AESVNKEMEPLVG--
G1RER8_BCL2L1-01        --------FFSFGGALC------------------VESVDKEMQVLVS--
                                :. *                                      

A0A2I3GEA7_BCL2L2-      -QVQEWMVAYLETRLADWIHSS----GGWEL-------EAIKARVREMEE
A0A2I3GJZ3_MCL1-01      ----------MEAPAADAIMSPEEELDGYEP-------EPLGKRPAVL--
A0A2I3GJZ3_MCL1-02      ----------MEAPAADAIMSPEEELDGYEP-------EPLGKRPAVL--
A0A2I3GZF9_BCL2-01      -NIALWMTEYLNRHLHTWIQDN----GGWDA-------------------
G1R3W6_BCL2L10-01       -RLVALLSSRLVGQHRAWLQAQ----GGWVSTRRTPGHGAGRAAGKRPRG
A0A2I3HBP6_BCL2A1-      KEISYFVAEFIMNNTGEWIRQN----GGWEN---------GFVKKFEPKS
A0A2I3HBP6_BCL2A1-      KEISYFVAEFIMNNTGEWIRQN----GGWGK-------------------
A0A2I3GEA7_BCL2L2-      -QVQEWMVAYLETRLADWIHSS----GGWAE-------------------
G1RER8_BCL2L1-01        -RIAAWMATYLNDHLEPWIQEN----GGWDT-------------------
                                  :       :       .*:                     

A0A2I3GEA7_BCL2L2-      EAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDY
A0A2I3GJZ3_MCL1-01      ---PLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLRE
A0A2I3GJZ3_MCL1-02      ---PLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLRE
A0A2I3GZF9_BCL2-01      ----FVELYGPSMRPLF-------D-------------------------
G1R3W6_BCL2L10-01       RHGWLLSLLQDPLSAGFLEKTAGPG-------------------------
A0A2I3HBP6_BCL2A1-      GWMTFLEVTGKISILLTRKDTPYCE-------------------------
A0A2I3HBP6_BCL2A1-      -WHNHMPM------------------------------------------
A0A2I3GEA7_BCL2L2-      ----FTALYGDGALEEARRLREGNW-------------------------
G1RER8_BCL2L1-01        ----FVELYGNNAAAESRKGQE----------------------------
                               :                                          

A0A2I3GEA7_BCL2L2-      GATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLA
A0A2I3GJZ3_MCL1-01      QATGAKDTKPMGRSGATSRKALETLRRVG-------------DGVQRN--
A0A2I3GJZ3_MCL1-02      QATGAKDTKPMGRSGATSRKALETLRRVG-------------DGVQRN--
A0A2I3GZF9_BCL2-01      ------------------------------------------FSWLSLKT
G1R3W6_BCL2L10-01       ------------------------------------------FSVMLVNN
A0A2I3HBP6_BCL2A1-      ------------------------------------------TGLIFLTL
A0A2I3HBP6_BCL2A1-      -------------------------------------------------L
A0A2I3GEA7_BCL2L2-      ------------------------------------------ASVRT--V
G1RER8_BCL2L1-01        --------------------------------------------------
                                                                          

A0A2I3GEA7_BCL2L2-      LDESLFRGRQIKV------IPKRTNRPGISTTDRGFPRARYRARTTNYNS
A0A2I3GJZ3_MCL1-01      -HETAFQGWVCGV-----------------LPCRGPRRW-----------
A0A2I3GJZ3_MCL1-02      -HETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2I3GZF9_BCL2-01      LLSLALVGACITL-------------------------------------
G1R3W6_BCL2L10-01       SLHLFLDTIIMSF-------------------------------------
A0A2I3HBP6_BCL2A1-      METIANTYFYFKI-------------------------------------
A0A2I3HBP6_BCL2A1-      VESVAHKKRKMAL-------------------------------------
A0A2I3GEA7_BCL2L2-      LTGAVALGALVTV-------------------------------------
G1RER8_BCL2L1-01        -----------RF-------------------------------------
                                    .                                     

A0A2I3GEA7_BCL2L2-      SRSRFYSGFNSRPRGRVYRGRARA------TSWYSPY-------------
A0A2I3GJZ3_MCL1-01      ----------HQKCAAGFCRCCWS------RSWF----------------
A0A2I3GJZ3_MCL1-02      FVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVE
A0A2I3GZF9_BCL2-01      ------------------------------GAYLGHK-------------
G1R3W6_BCL2L10-01       ------------------------------KTFNPLLPAQL---------
A0A2I3HBP6_BCL2A1-      ------------------------------NNFDDVT-------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      ------------------------------GAFFASK-------------
G1RER8_BCL2L1-01        ------------------------------NRWFLTG-------------
                                                                          

A0A2I3GEA7_BCL2L2-      ----------------------------
A0A2I3GJZ3_MCL1-01      -----------------GISNKIALL--
A0A2I3GJZ3_MCL1-02      DLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A2I3GZF9_BCL2-01      ----------------------------
G1R3W6_BCL2L10-01       ----------------------------
A0A2I3HBP6_BCL2A1-      ----------------------------
A0A2I3HBP6_BCL2A1-      ----------------------------
A0A2I3GEA7_BCL2L2-      ----------------------------
G1RER8_BCL2L1-01        ----------------------------
                                                    

© 1998-2020Legal notice