Dataset for protein BCL-2-like of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3GZF9_BCL2-01      -MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIF
G1R3W6_BCL2L10-01       ---MVDQLRERTERLLADYL---------------------------GCC
A0A2I3GJZ3_MCL1-03      --------MFGLRRNAVIGLNLYCGGAGLG--------------------
A0A2I3HBP6_BCL2A1-      ---MTDCEFGYIYRLAQDYLQYVLQI------------------------
A0A2I3HBP6_BCL2A1-      ---MTDCEFGYIYRLAQDYLQYVLQI------------------------
A0A2I3HBP6_BCL2A1-      ---MTDCEFGYIYRLAQDYLQYVLQI------------------------
G1RER8_BCL2L1-01        -------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTES
A0A2I3GEA7_BCL2L2-      --MATPASAPDTRALVADFVGYKLRQKGYV--------------------
A0A2I3GEA7_BCL2L2-      --MATPASAPDTRALVADFVGYKLRQKGYV--------------------
A0A2I3GEA7_BCL2L2-      GLRAVRGSGPGRRR--------HLVPRGRW--------------------
A0A2I3GJZ3_MCL1-02      --------MFGLRRNAVIGLNLYCGGAGLG--------------------
A0A2I3GJZ3_MCL1-01      --------MFGLRRNAVIGLNLYCGGAGLG--------------------
                                                                          

A0A2I3GZF9_BCL2-01      SSQPGHTPHPAASRDPVARTSPLPTPAAPGAAAGP------ALSPVPPVV
G1R3W6_BCL2L10-01       AREPG---------------TPEPTPSTPEAAMLR------SAAA-----
A0A2I3GJZ3_MCL1-03      -----------------------AGSGG-------------MLRK-----
A0A2I3HBP6_BCL2A1-      -----------------------PQPGSGPSKTSR------VLQN-----
A0A2I3HBP6_BCL2A1-      -----------------------PQPGSGPSKTSR------VLQN-----
A0A2I3HBP6_BCL2A1-      -----------------------PQPGSGPSKTSR------VLQN-----
G1RER8_BCL2L1-01        EMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQ-----
A0A2I3GEA7_BCL2L2-      -----------------------CGAGPGEGPAAD------PLHQ-----
A0A2I3GEA7_BCL2L2-      -----------------------CGAGPGEGPAAD------PLHQ-----
A0A2I3GEA7_BCL2L2-      -----------------------GGRGGGPRGPEE------LLLE-----
A0A2I3GJZ3_MCL1-02      -----------------------AGSGGATPPGGR------LL-------
A0A2I3GJZ3_MCL1-01      -----------------------AGSGGATPPGGR------LL-------
                                                  .                       

A0A2I3GZF9_BCL2-01      HLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEE--LFRDG
G1R3W6_BCL2L10-01       --RLRQLHPSFFSAY---LGYPGNRVELVVLMADSVLSD--------SPG
A0A2I3GJZ3_MCL1-03      --LDIKNEDDVKSLSRVMVHV------------------------FSDGV
A0A2I3HBP6_BCL2A1-      --VAFSVQKEVEKNLKPCLDNVN---VVSIDTARTLFNQVMEKE-FEDGI
A0A2I3HBP6_BCL2A1-      --VAFSVQKEVEKNLKPCLDNVN---VVSIDTARTLFNQVMEKE-FEDGI
A0A2I3HBP6_BCL2A1-      --VAFSVQKEVEKNLKPCLDNVN---VVSIDTARTLFNQVMEKE-FEDGI
G1RER8_BCL2L1-01        --ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNE--LFRDG
A0A2I3GEA7_BCL2L2-      --AMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQGG
A0A2I3GEA7_BCL2L2-      --AMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQGG
A0A2I3GEA7_BCL2L2-      --PEPEPEPEEEPPRPRAPPGAPGP---GPGSGAPGSQEEEEEPGLVEGD
A0A2I3GJZ3_MCL1-02      -------ATEKEASARREIGGGEAGAVIGGSAGASPPSVLTPDSRRVARP
A0A2I3GJZ3_MCL1-01      -------ATEKEASARREIGGGEAGAVIGGSAGASPPSVLTPDSRRVARP
                                 .                                        

A0A2I3GZF9_BCL2-01      VNWGRIVAFFEFGGVMC------------------VESVNREMSPLVD--
G1R3W6_BCL2L10-01       PTWGRVVTLVAFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQ--
A0A2I3GJZ3_MCL1-03      TNWGRIVTLISFGAFVA------------------KHLKTINQESCIE--
A0A2I3HBP6_BCL2A1-      INWGRIVTIFAFEGILV------------------KKLLRQRTAPDVDTY
A0A2I3HBP6_BCL2A1-      INWGRIVTIFAFEGILV------------------KKLLRQRTAPDVDTY
A0A2I3HBP6_BCL2A1-      INWGRIVTIFAFEGILV------------------KKLLRQRTAPDVDTY
G1RER8_BCL2L1-01        VNWGRIVAFFSFGGALC------------------VESVDKEMQVLVS--
A0A2I3GEA7_BCL2L2-      PNWGRLVAFFVFGAALC------------------AESVNKEMEPLVG--
A0A2I3GEA7_BCL2L2-      PNWGRLVAFFVFGAALC------------------AESVNKEMEPLVG--
A0A2I3GEA7_BCL2L2-      PGDGAI--------------------------------------------
A0A2I3GJZ3_MCL1-02      PPIGAE--------------------------------------------
A0A2I3GJZ3_MCL1-01      PPIGAE--------------------------------------------
                           *                                              

A0A2I3GZF9_BCL2-01      -NIALWMTEYLNRHLHTWIQDNGGWDA-----------------------
G1R3W6_BCL2L10-01       -RLVALLSSRLVGQHRAWLQAQGGWVSTRRTPGHGAGRAAGKRPRGRHGW
A0A2I3GJZ3_MCL1-03      -PLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEG-----------
A0A2I3HBP6_BCL2A1-      KEISYFVAEFIMNNTGEWIRQNGGWGK-----------------------
A0A2I3HBP6_BCL2A1-      KEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK--------------
A0A2I3HBP6_BCL2A1-      KEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK--------------
G1RER8_BCL2L1-01        -RIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAE-----------
A0A2I3GEA7_BCL2L2-      -QVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEE-----------
A0A2I3GEA7_BCL2L2-      -QVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEE-EAEKLKELQN
A0A2I3GEA7_BCL2L2-      ----------------------EDPELEAIKARVREMEE-EAEKLKELQN
A0A2I3GJZ3_MCL1-02      --------------VSDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMS
A0A2I3GJZ3_MCL1-01      --------------VSDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMS
                                                                          

A0A2I3GZF9_BCL2-01      FVELYGPSMRPLF-------DFSWLSLKTLLSLALVGACITLGAYLGHK-
G1R3W6_BCL2L10-01       LLSLLQDPLSAGFLEKTAGPGFSVMLVNNSLHLFLDTIIMSFKTFNPLLP
A0A2I3GJZ3_MCL1-03      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      EVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNV--DYGATAEELE
A0A2I3GEA7_BCL2L2-      EVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNV--DYGATAEELE
A0A2I3GJZ3_MCL1-02      PEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEE
A0A2I3GJZ3_MCL1-01      PEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEE
                                                                          

A0A2I3GZF9_BCL2-01      --------------------------------------------------
G1R3W6_BCL2L10-01       AQL-----------------------------------------------
A0A2I3GJZ3_MCL1-03      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
A0A2I3GEA7_BCL2L2-      ---------------------------ARRLREGNWASVRTVLT------
A0A2I3GEA7_BCL2L2-      AHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALD------
A0A2I3GEA7_BCL2L2-      AHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALD------
A0A2I3GJZ3_MCL1-02      DELYR----QSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVG
A0A2I3GJZ3_MCL1-01      DELYR----QSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVG
                                                                          

A0A2I3GZF9_BCL2-01      --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2I3GJZ3_MCL1-03      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
G1RER8_BCL2L1-01        ------------------------------------SRKGQERF------
A0A2I3GEA7_BCL2L2-      -------GAVALGALVTV--------------------------------
A0A2I3GEA7_BCL2L2-      -------ESLFRGRQIKV------IPKRTNRPGISTTDRGFPRARYRART
A0A2I3GEA7_BCL2L2-      -------ESLFRGRQIKV------IPKRTNRPGISTTDRGFPRARYRART
A0A2I3GJZ3_MCL1-02      DGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTL
A0A2I3GJZ3_MCL1-01      DGVQRNHETAFQGWVCGV-----------------LPCRGPRRW------
                                                                          

A0A2I3GZF9_BCL2-01      --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2I3GJZ3_MCL1-03      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      -------------------------------------WHNHMPM---LVE
A0A2I3HBP6_BCL2A1-      -----------------------------------SGWMTFLEVTGKICE
A0A2I3HBP6_BCL2A1-      -----------------------------------SGWMTFLEVTGKISI
G1RER8_BCL2L1-01        -----------------------------------NRWFLTG--------
A0A2I3GEA7_BCL2L2-      -----------------------------------GAFFASK--------
A0A2I3GEA7_BCL2L2-      TNYNSSRSRFYSGFNSRPRGRVYRGRARA------TSWYSPY--------
A0A2I3GEA7_BCL2L2-      TNYNSSRSRFYSGFNSRPRGRVYRGRARA------TSWYSPY--------
A0A2I3GJZ3_MCL1-02      ISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVE
A0A2I3GJZ3_MCL1-01      ---------------HQKCAAGFCRCCWS------RSWF-----------
                                                                          

A0A2I3GZF9_BCL2-01      ---------------------------------------
G1R3W6_BCL2L10-01       ---------------------------------------
A0A2I3GJZ3_MCL1-03      ---------GIRNVLLAFAGVAGVGAGLAYLIR------
A0A2I3HBP6_BCL2A1-      SVAHKKRKMAL----------------------------
A0A2I3HBP6_BCL2A1-      MLSFLKQ-YC-----------------------------
A0A2I3HBP6_BCL2A1-      LLTRKDTPYCETGLIFLTLMETIANTYFYFKINNFDDVT
G1RER8_BCL2L1-01        ---------------------------------------
A0A2I3GEA7_BCL2L2-      ---------------------------------------
A0A2I3GEA7_BCL2L2-      ---------------------------------------
A0A2I3GEA7_BCL2L2-      ---------------------------------------
A0A2I3GJZ3_MCL1-02      FFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR------
A0A2I3GJZ3_MCL1-01      ----------------------GISNKIALL--------
                                                               

© 1998-2020Legal notice