Dataset for protein BCL-2-like of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3GZF9_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFS
G1R3W6_BCL2L10-01       --MVDQLRERTERLLADYL---------------------------GCCA
A0A2I3HBP6_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIPQ------------PGSGPS-KTSR
A0A2I3HBP6_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIPQ------------PGSGPS-KTSR
G1RER8_BCL2L1-01        ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPE-GTES
A0A2I3GEA7_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKG------YVCGAGPGEGP--AADP
A0A2I3GEA7_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKG------YVCGAGPGEGP--AADP
A0A2I3GJZ3_MCL1-02      -------------------MFGLRRNAVIGLNLYCGGAGLGAGSG-GATP
A0A2I3GJZ3_MCL1-01      -------------------MFGLRRNAVIGLNLYCGGAGLGAGSG-GATP
                                                                          

A0A2I3GZF9_BCL2-01      SQPGHTPHPAASRDPVARTSPLPTPAAPGAAAGPALSPVPPVVHLTLRQA
G1R3W6_BCL2L10-01       REPG---------------TPEPTPSTPEAAMLRSAAA-------RLRQL
A0A2I3HBP6_BCL2A1-      -----------------------------------------VLQNVAFSV
A0A2I3HBP6_BCL2A1-      -----------------------------------------VLQNVAFSV
G1RER8_BCL2L1-01        EMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREA
A0A2I3GEA7_BCL2L2-      ------------------------------------------LHQAMRAA
A0A2I3GEA7_BCL2L2-      ------------------------------------------LHQAMRAA
A0A2I3GJZ3_MCL1-02      ------------------------------------------PGGRLLAT
A0A2I3GJZ3_MCL1-01      ------------------------------------------PGGRLLAT
                                                                          

A0A2I3GZF9_BCL2-01      GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDG-VNWGRIVA
G1R3W6_BCL2L10-01       HPSFFSAY---LGYPGNRVELVVLMADSVLSD------SPG-PTWGRVVT
A0A2I3HBP6_BCL2A1-      QKEVEKNLKPCLDNVNV---VSIDTARTLFNQVMEKEFEDGIINWGRIVT
A0A2I3HBP6_BCL2A1-      QKEVEKNLKPCLDNVNV---VSIDTARTLFNQVMEKEFEDGIINWGRIVT
G1RER8_BCL2L1-01        GDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDG-VNWGRIVA
A0A2I3GEA7_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVA
A0A2I3GEA7_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVA
A0A2I3GJZ3_MCL1-02      EKEASARREIGGGEAGAVIGGSAGASPPSVLTPDSRRVARP-PPIGAEVS
A0A2I3GJZ3_MCL1-01      EKEASARREIGGGEAGAVIGGSAGASPPSVLTPDSRRVARP-PPIGAEVS
                          .                      :   .               *  *:

A0A2I3GZF9_BCL2-01      --------FFEFGGVMC------------------VESVNREMSPLVD--
G1R3W6_BCL2L10-01       --------LVAFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQ--
A0A2I3HBP6_BCL2A1-      --------IFAFEGILV------------------KKLLRQRTAPDVDTY
A0A2I3HBP6_BCL2A1-      --------IFAFEGILV------------------KKLLRQRTAPDVDTY
G1RER8_BCL2L1-01        --------FFSFGGALC------------------VESVDKEMQVLVS--
A0A2I3GEA7_BCL2L2-      --------FFVFGAALC------------------AESVNKEMEPLVG--
A0A2I3GEA7_BCL2L2-      --------FFVFGAALC------------------AESVNKEMEPLVG--
A0A2I3GJZ3_MCL1-02      DVTATPARLLFFAPTRR------------------AAPLEE---------
A0A2I3GJZ3_MCL1-01      DVTATPARLLFFAPTRR------------------AAPLEE---------
                                :. *                                      

A0A2I3GZF9_BCL2-01      -NIALWMTEYLNRHLHTWIQDN----GGWDA-------------------
G1R3W6_BCL2L10-01       -RLVALLSSRLVGQHRAWLQAQ----GGWVSTRRTPGHGAGRAAGKRPRG
A0A2I3HBP6_BCL2A1-      KEISYFVAEFIMNNTGEWIRQN----GGWENGFVKKFEPKSGWM--T---
A0A2I3HBP6_BCL2A1-      KEISYFVAEFIMNNTGEWIRQN----GGWGK-----------WH--N---
G1RER8_BCL2L1-01        -RIAAWMATYLNDHLEPWIQEN----GGWD----------------T---
A0A2I3GEA7_BCL2L2-      -QVQEWMVAYLETRLADWIHSS----GGWA----------------E---
A0A2I3GEA7_BCL2L2-      -QVQEWMVAYLETRLADWIHSS----GGWELEAIKARVREMEEEAEK---
A0A2I3GJZ3_MCL1-02      ----------MEAPAADAIMSPEEELDGYEPEPLGKRPAVL-----P---
A0A2I3GJZ3_MCL1-01      ----------MEAPAADAIMSPEEELDGYEPEPLGKRPAVL-----P---
                                  :       :       .*:                     

A0A2I3GZF9_BCL2-01      ----FVELYGPSMRPLF-------DFSWLSLKTLLSLALVGACITLGAYL
G1R3W6_BCL2L10-01       RHGWLLSLLQDPLSAGFLEKTAGPGFSVMLVNNSLHLFLDTIIMSFKTFN
A0A2I3HBP6_BCL2A1-      ----FLEVTGKISILLTRKDTPYCETGLIFLTLMETIANTYFYFKINNFD
A0A2I3HBP6_BCL2A1-      ----HMPM------------------------LVESVAHKKRKMAL----
G1RER8_BCL2L1-01        ----FVELYGNNAAAESRKGQERF--------------------------
A0A2I3GEA7_BCL2L2-      ----FTALYGDG--------------------------------------
A0A2I3GEA7_BCL2L2-      ----LKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDY
A0A2I3GJZ3_MCL1-02      ----LLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLRE
A0A2I3GJZ3_MCL1-01      ----LLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLRE
                               :                                          

A0A2I3GZF9_BCL2-01      GHK-----------------------------------------------
G1R3W6_BCL2L10-01       PLLPAQL-------------------------------------------
A0A2I3HBP6_BCL2A1-      DVT-----------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
A0A2I3GEA7_BCL2L2-      ---ALEEARRLREGNWASVRTVL---------------------------
A0A2I3GEA7_BCL2L2-      GATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLA
A0A2I3GJZ3_MCL1-02      QATGAKDTKPMGRSGATSRKALETLRRVG-------------DGVQRN--
A0A2I3GJZ3_MCL1-01      QATGAKDTKPMGRSGATSRKALETLRRVG-------------DGVQRN--
                                                                          

A0A2I3GZF9_BCL2-01      --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
G1RER8_BCL2L1-01        --------------------------------------------------
A0A2I3GEA7_BCL2L2-      -TGAVALGALVTV-------------------------------------
A0A2I3GEA7_BCL2L2-      LDESLFRGRQIKV------IPKRTNRPGISTTDRGFPRARYRARTTNYNS
A0A2I3GJZ3_MCL1-02      -HETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A2I3GJZ3_MCL1-01      -HETAFQGWVCGV-----------------LPCRGPRRW-----------
                                                                          

A0A2I3GZF9_BCL2-01      --------------------------------------------------
G1R3W6_BCL2L10-01       --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
A0A2I3HBP6_BCL2A1-      --------------------------------------------------
G1RER8_BCL2L1-01        ------------------------------NRWFLTG-------------
A0A2I3GEA7_BCL2L2-      ------------------------------GAFFASK-------------
A0A2I3GEA7_BCL2L2-      SRSRFYSGFNSRPRGRVYRGRARA------TSWYSPY-------------
A0A2I3GJZ3_MCL1-02      FVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVE
A0A2I3GJZ3_MCL1-01      ----------HQKCAAGFCRCCWS------RSWF----------------
                                                                          

A0A2I3GZF9_BCL2-01      ----------------------------
G1R3W6_BCL2L10-01       ----------------------------
A0A2I3HBP6_BCL2A1-      ----------------------------
A0A2I3HBP6_BCL2A1-      ----------------------------
G1RER8_BCL2L1-01        ----------------------------
A0A2I3GEA7_BCL2L2-      ----------------------------
A0A2I3GEA7_BCL2L2-      ----------------------------
A0A2I3GJZ3_MCL1-02      DLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A2I3GJZ3_MCL1-01      -----------------GISNKIALL--
                                                    

© 1998-2020Legal notice