Dataset for protein BCL-2-like of organism Nomascus leucogenys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                            .   
----t---mpgtrrlavdylqyklqq-g---------------------------------------------pgpgsgp
gmmm-dcsfgylyenvqigvnlycgik-yvwsqgsvveeprteapepgisssepgstpnpnpswhpvdsttpnaqssgpe
 lravpaegfdiea--a-f---v-sgr lg dafddgaanpga  agteferqtphaihgaa rdlaarpsvlgtaapat
  aharrtaysn  il-k-ig - r-a rw                  ccam                  a ecat ass
     gqmsqrr    m   s h -p   s                                             r t g
      glre          h   v    e                                             l h  
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             .                                           *      
sptsr------vl---------vlrsagdefekrlrrclsnvn---vvtpgtartrfsqvmee--lfdggpnwGrivtff
gkagdevipmal-qqvppvvhlaaf-vqkdvvtsykptfggleaqlhisidsgaslpnv---kerfvrriipi al-a--
pgmap      pvhn       ---q-atsksanf--eiddgasga--ggsa-qqp-t-lvp-sgreqdpvtd  e -iv
aagle      aasp       tmpepnp efspas apvyp-nrvel---- ---s-tetddp --apvtg   v  li
rlpe       - le       redalhe d rarp -mphmtgp   vvlm ypvlqe sn    ss d          
  d        s ka       p  ike    p    v aeas       f  dgs ed e      e            
             a        k         l    d    p            g a                      
                                          g                                     
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
afgg-lc------------------kksv--emaplvd----i--wmaeyl---lgdwirqnggwenfa-k-rv-a-ee-
----i--ergplvtarwkkwgfqpr-el-rq----d--tyke-sy------mnntsevtqtsarldl--vtyg-r-l--m
v eaavv                  v--lnkrtev-ig   rvaefvvafivtrvr--lhsqrdplfgvp-r-eppmrga
s a vml                  aheqtrnvssccs   qlqaslttv nrh-at -a-pe  vtefilkfagkgaa 
e   t a                  l  keidqqr  q   p vllissr egtk-p  -k-   gsttefahnaea   
    f                        dg      e   n      d   dqhha  ve    ak rr p hnd    
                                                       e    d     g  a f de     
                                                            a     e             
                                                                  a             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
eapklkelqspvellmnysppplnkrpavmslselvgesgrstyvdgvlpsygataeeleahlyrcgsvqsvtilsryls
gkeaadaimneeskqdgmeselggagtvilpilwkmeadannlstgnsimdtpppnplepdefhg    nrle icdkfr
  rprgrhgwll eyqpsmragflek  gpgfevmsvntslhiflvticitlktylghk  q                  
          f    gdpl           d    llknl   a   a   f  f                         
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gqptgfkytkpsgrssattrlaletlrrvgdgvqrnhetlfrgrqikvdiknedipkrtnrpgisttdrgfprwryrart
ehak aadiefmdkegvrsskv d             gsaaq wlvtl      dv sls vmvhvssk vtnagrivtl
       arrlregnw sv t  t              av l mvrg                  lprd qr f      
                                           a c                    fc  pe        
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------w------------------------------------------
tnynssrsrfysgfnsrprgrvyrgraravlvrtkts-ftpyevtgkivesltvkktyygirnvllafagvagvgaglay
isfgafvakhlkti qqscieplcrsiws      sgfysflrmwdglsimvsrldrpmcltglifltlmetiistyiyl
               hek aagfaecctd      rr mvtqpg   fc lfhhe qkgae            annkf f
                                   nd lnsm        f af  lec                     
                                   ga hlkk                                      
                                       ahg                                      
                                                                                
                                                                                

         
....:....
         
---------
lirnfddvt
k n      
         
         
         
         
         
         
© 1998-2022Legal notice