Dataset for protein BCL-2-like of organism Nomascus leucogenys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
 aavpaeagynyeiaqk-vg-g qinavsgsqgsdgaanpga  agteferqtphaihgaa rdlaarpcgnpqtaesgg
  hagrtsysiea lv  i- - ---  e dafd             ccam                  tclga  t e-
     qmrqr     m   s     r                                           sve    h   
      lge          h                                                 a          

        90       100       110       120       130       140       150       160
                      .                      :   .               *  *:        :.
ktsppggpvpvlqqlamlsvqdsvsknrkpglgdvnv---lsidssqtrvntpssrrvqrpivpi al tdvtatparll
gd--svsamapvvn vafqtepdafaaleicgdnaasviggvala ppllld-mdke-eg  it   e s        iv
lml llq   a kh t  elh    s f--- ayptnrvei vfm ysv s  d--- ap       v            
  g ehi     h            r    d   ms          dg  e  -n   s                     
  d aaa                  l    a                   a                             

       170       180       190       200       210       220       230       240
 *                                                :       :       .*:           
v aparvergplvtarwkkwgfqprvkpleq----d--tykr-sy-----mnnptgealrqseeeld ydttrrtpghep
f eaimr                  kalqrertev-cg   qvqefvvafimanart  mep       vs       ga
s   v l                  l e drdvsr  s   elaallttr vrhhhp  hdq       gn         
e                             g  q   q   n vl  ss   gq ea   a        al         
                                                    d                 k         

       250       260       270       280       290       300       310       320
grakvrelkgghhwhtpm-q-v-s-e-tdpslpnwg vimsi ekmeadars yvgnvdyg  aeeleahfhgc svn v
ikvakkrmeeeagt ma tnppsrq-tmslreypg                                             
 f  gf      en k  q nnmlpmnlrkqa ce                                             
             k    l kilklga edp   d                                             
                     geie         a                                             

       330       340       350       360       370       380       390       400
tilcdkfs              d-wqrlnvve--v-vy-y-sf      dp rln pgihtpdd prnagriarlinfga
                      t lmsvlts-tvlnttwvvri                 lfc  fp             
                      e  llsknmthsfhrkmqrg                                      
                      a  if  a dgi al ikfa                                      
                                 a  k fic                                       
                                    d  c                                        

       410       420       430       440       450       460       470        
frakflkgf qqprgeplcgrctd      g---stypaqd                           igagi l   
          hek aagfaecara      -tyypst                                         
                              tr nlpq                                         
                              kn dgll                                         
                               d  dkg                                         
© 1998-2020Legal notice