Dataset for protein Mcl-1 of organism Mus spicilegus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6GJU8_MCL1-02      MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAAL
A0A8C6GJU8_MCL1-03      MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAAL
A0A8C6GJU8_MCL1-01      MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAAL
                        **************************************************

A0A8C6GJU8_MCL1-02      LPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAI
A0A8C6GJU8_MCL1-03      LPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAI
A0A8C6GJU8_MCL1-01      LPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAI
                        **************************************************

A0A8C6GJU8_MCL1-02      VSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEE
A0A8C6GJU8_MCL1-03      VSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEE
A0A8C6GJU8_MCL1-01      VSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEE
                        **************************************************

A0A8C6GJU8_MCL1-02      EEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDG
A0A8C6GJU8_MCL1-03      EEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDG
A0A8C6GJU8_MCL1-01      EEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDG
                        **************************************************

A0A8C6GJU8_MCL1-02      VQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLIS
A0A8C6GJU8_MCL1-03      VQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLIS
A0A8C6GJU8_MCL1-01      VQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLIS
                        **************************************************

A0A8C6GJU8_MCL1-02      FGAFVAKHLKSVNQESCIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFF
A0A8C6GJU8_MCL1-03      FGAFVAKHLKSVNQESCIEPLAETITDVLVRTKRDWLVKQRGWVVLL-IQ
A0A8C6GJU8_MCL1-01      FGAFVAKHLKSVNQESCIEPLAETITDVLVRTKRDWLVKQRGWPPWLKVQ
                        *******************************************   : . 

A0A8C6GJU8_MCL1-02      HVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A8C6GJU8_MCL1-03      LDNLQSSGFKP--------------------
A0A8C6GJU8_MCL1-01      PHFTVTCSYKGSQSPNC--------------
                               . .                     

© 1998-2022Legal notice