Dataset for protein Mcl-1 of organism Mus spicilegus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C6GJU8_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Mus spicilegus GN=MCL-1 (length=310 residues).
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHK
SPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSL
EIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVT
NWGRIVTLISFGAFVAKHLKSVNQESCIEPLAETITDVLVRTKRDWLVKQRGWVVLLIQLDNLQSSGFKP
>gnl|bcl2dbpro|A0A8C6GJU8_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Mus spicilegus GN=MCL-1 (length=331 residues).
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHK
SPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSL
EIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVT
NWGRIVTLISFGAFVAKHLKSVNQESCIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVA
GVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C6GJU8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Mus spicilegus GN=MCL-1 (length=317 residues).
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHK
SPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSL
EIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVT
NWGRIVTLISFGAFVAKHLKSVNQESCIEPLAETITDVLVRTKRDWLVKQRGWPPWLKVQPHFTVTCSYKGSQSPNC
© 1998-2022Legal notice