Dataset for protein BCL-2-like of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

29 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P70345_BCL2L2-03       --------------------------------------------------
Q64373_BCL2L1-07       --------------------------------------------------
Q64373_BCL2L1-08       --------------------------------------------------
D3Z5F7_BCL2L2-01       --------------------------------------------------
P97287_MCL1-02         MFGLRRNAVIGLNLYCG---------------------------------
P97287_MCL1-01         MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAAL
O55178_BCL2A1-01       --------------------------------------------------
Q0P538_BCL2A1-01       --------------------------------------------------
Q07440_BCL2A1-01       --------------------------------------------------
O55179_BCL2A1-01       --------------------------------------------------
O55177_BCL2A1-02       --------------------------------------------------
Q497M6_BCL2A1-01       --------------------------------------------------
Q8K164_BCL2A1-01       --------------------------------------------------
Q4FK02_BCL2A1-01       --------------------------------------------------
Q9Z0F3_BCL2L10-01      --------------------------------------------------
P70345_BCL2L2-05       --------------------------------------------------
P70345_BCL2L2-01       --------------------------------------------------
P70345_BCL2L2-04       --------------------------------------------------
P10417_BCL2-01         --------------------------------------------------
P10417_BCL2-02         --------------------------------------------------
Q6NTH7_BCL2-01         --------------------------------------------------
Q64373_BCL2L1-06       --------------------------------------------------
Q64373_BCL2L1-05       --------------------------------------------------
Q64373_BCL2L1-03       --------------------------------------------------
Q64373_BCL2L1-04       --------------------------------------------------
O35843_BCL2L1-01       --------------------------------------------------
Q5HZH3_BCL2L1-02       --------------------------------------------------
Q64373_BCL2L1-01       --------------------------------------------------
Q64373_BCL2L1-09       --------------------------------------------------
                                                                         

P70345_BCL2L2-03       -------------------------------MEPLVGQVQDWMVAYLETR
Q64373_BCL2L1-07       ----------------------------------MSQSNRELVVDFLSYK
Q64373_BCL2L1-08       ----------------------------------MSQSNRELVVDFLSYK
D3Z5F7_BCL2L2-01       ----------MATPASTPDTRA-------------------LVADFVGYK
P97287_MCL1-02         -------------GAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAI
P97287_MCL1-01         LPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAI
O55178_BCL2A1-01       ------------------------------MAEYELMHIHSLAEHYLQYV
Q0P538_BCL2A1-01       ------------------------------MAEYELMHIHSLAEHYLQYV
Q07440_BCL2A1-01       ------------------------------MAESELMHIHSLAEHYLQYV
O55179_BCL2A1-01       ------------------------------MSEYEFMYIHSLAEHYLQYV
O55177_BCL2A1-02       ------------------------------MAEYEFMYIHSLAEHYLQYV
Q497M6_BCL2A1-01       ------------------------------MAEYEFMYIHSLAEHYLQYV
Q8K164_BCL2A1-01       ------------------------------MAEYEFMYIHSLAEHYLQYV
Q4FK02_BCL2A1-01       ------------------------------MSEYEFMYIHSLAEHYLQYV
Q9Z0F3_BCL2L10-01      ---------------------------MADSQDPLHERTRRLLSDYIFF-
P70345_BCL2L2-05       -----------------------------MATPASTPDTRALVADFVGYK
P70345_BCL2L2-01       -----------------------------MATPASTPDTRALVADFVGYK
P70345_BCL2L2-04       -----------------------------MATPASTPDTRALVADFVGYK
P10417_BCL2-01         ----------------------------MAQAGRTGYDNREIVMKYIHYK
P10417_BCL2-02         ----------------------------MAQAGRTGYDNREIVMKYIHYK
Q6NTH7_BCL2-01         ----------------------------MAQAGRTGYDNREIVMKYIHYK
Q64373_BCL2L1-06       ----------------------------MSQS------NRELVVDFLSYK
Q64373_BCL2L1-05       ----------------------------MSQS------NRELVVDFLSYK
Q64373_BCL2L1-03       ----------------------------MSQS------NRELVVDFLSYK
Q64373_BCL2L1-04       ----------------------------MSQS------NRELVVDFLSYK
O35843_BCL2L1-01       ----------------------------MSQS------NRELVVDFLSYK
Q5HZH3_BCL2L1-02       ----------------------------MSQS------NRELVVDFLSYK
Q64373_BCL2L1-01       ----------------------------MSQS------NRELVVDFLSYK
Q64373_BCL2L1-09       ----------------------------MSQS------NRELVVDFLSYK
                                                                         

P70345_BCL2L2-03       LADWIHSSGGWAEFTALYGD--GALEEARRLREG--------NWASVRTV
Q64373_BCL2L1-07       LS---QKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWH-----
Q64373_BCL2L1-08       LS---QKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWH-----
D3Z5F7_BCL2L2-01       LR---QKGYVCGAGP---GEGPAADPL-----------------------
P97287_MCL1-02         VS---PEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLP-----
P97287_MCL1-01         VS---PEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLP-----
O55178_BCL2A1-01       LQ---VPAF-----------------------------------------
Q0P538_BCL2A1-01       LQ---VPAF-----------------------------------------
Q07440_BCL2A1-01       LQ---VPAF-----------------------------------------
O55179_BCL2A1-01       LQ---VPAF-----------------------------------------
O55177_BCL2A1-02       LQ---VPAF-----------------------------------------
Q497M6_BCL2A1-01       LQ---VPAF-----------------------------------------
Q8K164_BCL2A1-01       LQ---VPAF-----------------------------------------
Q4FK02_BCL2A1-01       LQ---VPAF-----------------------------------------
Q9Z0F3_BCL2L10-01      -----------------------CAREPDTPEPPPTSV------------
P70345_BCL2L2-05       LR---QKGY-----------------------------------------
P70345_BCL2L2-01       LR---QKGY-----------------------------------------
P70345_BCL2L2-04       LR---QKGY-----------------------------------------
P10417_BCL2-01         LS---QRGYEW--------DAGDADAAPLGAAPTPGIFSFQPESN-----
P10417_BCL2-02         LS---QRGYEW--------DAGDADAAPLGAAPTPGIFSFQPESN-----
Q6NTH7_BCL2-01         LS---QRGYEW--------DAGDADAAPLGAAPTPGIFSFQPESN-----
Q64373_BCL2L1-06       LS---QKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWH-----
Q64373_BCL2L1-05       LS---QKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWH-----
Q64373_BCL2L1-03       LS---QKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWH-----
Q64373_BCL2L1-04       LS---QKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWH-----
O35843_BCL2L1-01       LS---QKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWH-----
Q5HZH3_BCL2L1-02       LS---QKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWH-----
Q64373_BCL2L1-01       LS---QKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWH-----
Q64373_BCL2L1-09       LS---QKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWH-----
                                                                         

P70345_BCL2L2-03       LTGAVALGAL-----------VTVGAFFASK-------------------
Q64373_BCL2L1-07       LADSPAVNGA-----------TGHSSSLDAREVIPMAA---------VKQ
Q64373_BCL2L1-08       LADSPAVNGA-----------TGHSSSLDAR-------------------
D3Z5F7_BCL2L2-01       ------------------------------------------------HQ
P97287_MCL1-02         STPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALE
P97287_MCL1-01         STPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALE
O55178_BCL2A1-01       -----------------------------------------ESAPSQAFR
Q0P538_BCL2A1-01       -----------------------------------------ESAPSQAFR
Q07440_BCL2A1-01       -----------------------------------------ESAPSQACR
O55179_BCL2A1-01       -----------------------------------------ESAPSQACR
O55177_BCL2A1-02       -----------------------------------------ESAPSQACR
Q497M6_BCL2A1-01       -----------------------------------------ESAPSKACR
Q8K164_BCL2A1-01       -----------------------------------------ESAPSQACR
Q4FK02_BCL2A1-01       -----------------------------------------ESAPSKACR
Q9Z0F3_BCL2L10-01      -----------------------------------------------EAA
P70345_BCL2L2-05       ---------------------------------VCGAGPGEGPAADPLHQ
P70345_BCL2L2-01       ---------------------------------VCGAGPGEGPAADPLHQ
P70345_BCL2L2-04       ---------------------------------VCGAGPGEGPAADPLHQ
P10417_BCL2-01         --PMPAVHRD-----------MAARTS-PLRPLVATAGPALSPVPPVVHL
P10417_BCL2-02         --PMPAVHRD-----------MAARTS-PLRPLVATAGPALSPVPPVVHL
Q6NTH7_BCL2-01         --PMPAVHRD-----------MAARTS-PLRPLVATAGPALSPVPPVVHL
Q64373_BCL2L1-06       LADSPAVNGA-----------TGHSSSLDAREVIPMAA---------VKQ
Q64373_BCL2L1-05       LADSPAVNGA-----------TGHSSSLDAREVIPMAA---------VKQ
Q64373_BCL2L1-03       LADSPAVNGA-----------TGHSSSLDAREVIPMAA---------VKQ
Q64373_BCL2L1-04       LADSPAVNGA-----------TGHSSSLDAREVIPMAA---------VKQ
O35843_BCL2L1-01       LADSPAVNGA-----------TGHSSSLDAREVIPMAA---------VKQ
Q5HZH3_BCL2L1-02       LADSPAVNGA-----------TGHSSSLDAREVIPMAA---------VKQ
Q64373_BCL2L1-01       LADSPAVNGA-----------TGHSSSLDAREVIPMAA---------VKQ
Q64373_BCL2L1-09       LADSPAVNGA-----------TGHSSSLDAREVIPMAA---------VKQ
                                                                         

P70345_BCL2L2-03       --------------------------------------------------
Q64373_BCL2L1-07       ALREAGDE------------------------------------------
Q64373_BCL2L1-08       --------------------------------------------------
D3Z5F7_BCL2L2-01       AMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQGG-P-
P97287_MCL1-02         TLRRVGDGVQRNHETAFQGMLRKLDIKN-EGDVKSFSRVMVHVFKDGVT-
P97287_MCL1-01         TLRRVGDGVQRNHETAFQGMLRKLDIKN-EGDVKSFSRVMVHVFKDGVT-
O55178_BCL2A1-01       VLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVMEKEFEDGII-
Q0P538_BCL2A1-01       VLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVMEKEFENGII-
Q07440_BCL2A1-01       VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGII-
O55179_BCL2A1-01       VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGII-
O55177_BCL2A1-02       VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGII-
Q497M6_BCL2A1-01       VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGII-
Q8K164_BCL2A1-01       VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGII-
Q4FK02_BCL2A1-01       VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGII-
Q9Z0F3_BCL2L10-01      LLRSVTRQIQQEHQEFFSSFCE----SR-GNRLELVKQMADKLLSKDQDF
P70345_BCL2L2-05       AMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQGGPN-
P70345_BCL2L2-01       AMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQGGPN-
P70345_BCL2L2-04       AMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQGGPN-
P10417_BCL2-01         TLRRAGDDFSRRYRRDFAEMSSQLHLTP-FTARGRFATVVEELFRDGVN-
P10417_BCL2-02         TLRRAGDDFSRRYRRDFAEMSSQLHLTP-FTARGRFATVVEELFRDGVN-
Q6NTH7_BCL2-01         TLRRAGDDFSRRYRRDFAEMSSQLHLTP-FTARGRFATVVEELFRDGVN-
Q64373_BCL2L1-06       ALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGVN-
Q64373_BCL2L1-05       ALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGVN-
Q64373_BCL2L1-03       ALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGVN-
Q64373_BCL2L1-04       ALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGVN-
O35843_BCL2L1-01       ALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGVN-
Q5HZH3_BCL2L1-02       ALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGVN-
Q64373_BCL2L1-01       ALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGVN-
Q64373_BCL2L1-09       ALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGVN-
                                                                         

P70345_BCL2L2-03       --------------------------------------------------
Q64373_BCL2L1-07       --------------------------------------------------
Q64373_BCL2L1-08       --------------------------------------------------
D3Z5F7_BCL2L2-01       NWGRLVAFFVFGAAL--------CAESVNKEMEPLV---GQVQDWMVAYL
P97287_MCL1-02         NWGRIVTLISFGAFV--------AKHLKSVNQESFI---EPLAETITDVL
P97287_MCL1-01         NWGRIVTLISFGAFV--------AKHLKSVNQESFI---EPLAETITDVL
O55178_BCL2A1-01       NWGRIVTIFAFGGVL--------LKKTSTRADCPGC--------------
Q0P538_BCL2A1-01       NWGRIVTIFAFGGVL--------LKKTSTRADCPGC--------------
Q07440_BCL2A1-01       NWGRIVTIFAFGGVL--------LKKLPQEQIALDVCAYKQVSSFVAEFI
O55179_BCL2A1-01       NWGRIVTIFAFGGVL--------LKKLPQEQIALDVGAYKQVSSFVAEFI
O55177_BCL2A1-02       NWGRIVTIFAFGGVL--------LKKLPQEQIALDVGAYKQVSSFVAEFI
Q497M6_BCL2A1-01       NWGRIVTIFAFGGVL--------LKKLPQEQIALDVGAYKQVSSFVAEFI
Q8K164_BCL2A1-01       NWGRIVTIFAFGGVL--------LKKLPQEQIALDVGAYKQVSSFVAEFI
Q4FK02_BCL2A1-01       NWGRIVTIFAFGGVL--------LKKLPQEQIALDVGAYKQVSSFVAEFI
Q9Z0F3_BCL2L10-01      SWSQLVMLLAFAGTLMNQGPYMAVKQKRDLGNRVIV---TRDCCLIVNFL
P70345_BCL2L2-05       -WGRLVAFFVFGAAL--------CAESVNKEMEP----------------
P70345_BCL2L2-01       -WGRLVAFFVFGAAL--------CAESVNKEMEPLV---GQVQDWMVAYL
P70345_BCL2L2-04       -WGRLVAFFVFGAAL--------CAESVNKEMEPLV---GQVQDWMVAYL
P10417_BCL2-01         -WGRIVAFFEFGGVM--------CVESVNREMSPLV---DNIALWMTEYL
P10417_BCL2-02         -WGRIVAFFEFGGVM--------CVESVNREMSPLV---DNIALWMTEYL
Q6NTH7_BCL2-01         -WGRIVAFFEFGGVM--------CVESVNREMSPLV---DNIALWMTEYL
Q64373_BCL2L1-06       -WGRIVAFFSFGGAL--------CVES-----------------------
Q64373_BCL2L1-05       -WGRIVAFFSFGGAL--------CVESVDKEMQVLV---SRIASWMATYL
Q64373_BCL2L1-03       -WGRIVAFFSFGGAL--------CVESVDKEMQVLV---SRIASWMATYL
Q64373_BCL2L1-04       -WGRIVAFFSFGGAL--------CVESVDKEMQVLV---SRIASWMATYL
O35843_BCL2L1-01       -WGRIVAFFSFGGAL--------CVESVDKEMQVLV---SRIASWMATYL
Q5HZH3_BCL2L1-02       -WGRIVAFFSFGGAL--------CVESVDKEMQVLV---SRIASWMATYL
Q64373_BCL2L1-01       -WGRIVAFFSFGGAL--------CVESVDKEMQVLV---SRIASWMATYL
Q64373_BCL2L1-09       -WGRIVAFFSFGGAL--------CVESVDKEMQVLV---SRIASWMATYL
                                                                         

P70345_BCL2L2-03       --------------------------------------------------
Q64373_BCL2L1-07       --------------------------------------------------
Q64373_BCL2L1-08       --------------------------------------------------
D3Z5F7_BCL2L2-01       ETRL-----ADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMN
P97287_MCL1-02         VRTK-----RDWLVKQRGWDGFVEFFHVQDLE------------------
P97287_MCL1-01         VRTK-----RDWLVKQRGWDGFVEFFHVQDLE------------------
O55178_BCL2A1-01       ----------------------------------TCLQTSFQFWGRIHNE
Q0P538_BCL2A1-01       ----------------------------------TCLQTSFQFWGRIHHE
Q07440_BCL2A1-01       MNNT-----GEWIRQNGGWEDGFIKKFEPKSGWLTFLQMTGQIWEMLFLL
O55179_BCL2A1-01       MNNT-----GEWIRRNGGWEDGFIKKFEPKSGWLTFLQMTGQIWEMLFLL
O55177_BCL2A1-02       INNT-----GEWIRRNGGWEDGFIKKFEPKSGWLTFLQMTGQFWEMLFLL
Q497M6_BCL2A1-01       INNT-----GEWIRRNGGWEDGFIKKFEPKSGWLTFLQMTGQFWEMLFLL
Q8K164_BCL2A1-01       INNT-----GEWIRRNGGWEDGFIKKFEPKSGWLTFLQMTGQIWEMLFLL
Q4FK02_BCL2A1-01       INNT-----GEWIRRNGGWEDGFIKKFEPKSGWLTFLQMTGQFWEMLFLL
Q9Z0F3_BCL2L10-01      YNLLMGRRHRARLEALGGWDGFCRFFKNPLP----------LGFWRRLLI
P70345_BCL2L2-05       --------------------------------------------------
P70345_BCL2L2-01       ETRL-----ADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLT
P70345_BCL2L2-04       ETRL-----ADWIHSSGGWVRSSQLLLSASL-----YKVGLHGKIGPLMG
P10417_BCL2-01         NRHL-----HTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALV
P10417_BCL2-02         NRHL-----HTWIQDNGGW------------------------------V
Q6NTH7_BCL2-01         NRHL-----HTWIQDNGGW------------------------------V
Q64373_BCL2L1-06       --------------------------------------------------
Q64373_BCL2L1-05       NDHL-----EPWIQENGGW-------------------------------
Q64373_BCL2L1-03       NDHL-----EPWIQENGGWVR------------------------TTPLV
Q64373_BCL2L1-04       NDHL-----EPWIQENGGWVR------------------------TTPLV
O35843_BCL2L1-01       NDHL-----EPWIQENGGWGV--------------SGGTPLRSVFRRLVQ
Q5HZH3_BCL2L1-02       NDHL-----EPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMT
Q64373_BCL2L1-01       NDHL-----EPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMT
Q64373_BCL2L1-09       NDHL-----EPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMT
                                                                         

P70345_BCL2L2-03       --------------------------------------------------
Q64373_BCL2L1-07       --------------------------------------------------
Q64373_BCL2L1-08       --------------------------------------------------
D3Z5F7_BCL2L2-01       MSPPPGNAGPVIMSLEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSV
P97287_MCL1-02         -----------------------------------------------GGI
P97287_MCL1-01         -----------------------------------------------GGI
O55178_BCL2A1-01       --------------------------------------------------
Q0P538_BCL2A1-01       --------------------------------------------------
Q07440_BCL2A1-01       K-------------------------------------------------
O55179_BCL2A1-01       K-------------------------------------------------
O55177_BCL2A1-02       K-------------------------------------------------
Q497M6_BCL2A1-01       K-------------------------------------------------
Q8K164_BCL2A1-01       K-------------------------------------------------
Q4FK02_BCL2A1-01       K-------------------------------------------------
Q9Z0F3_BCL2L10-01      QAFLSGFFATAIFFIWKRL-------------------------------
P70345_BCL2L2-05       --------------------------------------------------
P70345_BCL2L2-01       GAVALGALVTVGAFFASK--------------------------------
P70345_BCL2L2-04       GWGCAGKG------------------------------------------
P10417_BCL2-01         GACITLGAYLGHK-------------------------------------
P10417_BCL2-02         GACLVE--------------------------------------------
Q6NTH7_BCL2-01         GACLVE--------------------------------------------
Q64373_BCL2L1-06       --------------------------------------------------
Q64373_BCL2L1-05       --------------------------------------------------
Q64373_BCL2L1-03       CPPL---ACVSLLCEHP---------------------------------
Q64373_BCL2L1-04       CPPL---ACVSLLCEHP---------------------------------
O35843_BCL2L1-01       VPGVAEHVCDPSLWEVETEGSEVQGPPQLL--------------------
Q5HZH3_BCL2L1-02       VAGV---VLLGSLFSRK---------------------------------
Q64373_BCL2L1-01       VAGV---VLLGSLFSRK---------------------------------
Q64373_BCL2L1-09       VAGV---VLLGSLFSRK---------------------------------
                                                                         

P70345_BCL2L2-03       --------------------------------------------------
Q64373_BCL2L1-07       --------------------------------------------------
Q64373_BCL2L1-08       --------------------------------------------------
D3Z5F7_BCL2L2-01       NRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKR
P97287_MCL1-02         RNVLLAFAGVAGVGAGLAYL-------IR---------------------
P97287_MCL1-01         RNVLLAFAGVAGVGAGLAYL-------IR---------------------
O55178_BCL2A1-01       --------------------------------------------------
Q0P538_BCL2A1-01       --------------------------------------------------
Q07440_BCL2A1-01       --------------------------------------------------
O55179_BCL2A1-01       --------------------------------------------------
O55177_BCL2A1-02       --------------------------------------------------
Q497M6_BCL2A1-01       --------------------------------------------------
Q8K164_BCL2A1-01       --------------------------------------------------
Q4FK02_BCL2A1-01       --------------------------------------------------
Q9Z0F3_BCL2L10-01      --------------------------------------------------
P70345_BCL2L2-05       --------------------------------------------------
P70345_BCL2L2-01       --------------------------------------------------
P70345_BCL2L2-04       --------------------------------------------------
P10417_BCL2-01         --------------------------------------------------
P10417_BCL2-02         --------------------------------------------------
Q6NTH7_BCL2-01         --------------------------------------------------
Q64373_BCL2L1-06       --------------------------------------------------
Q64373_BCL2L1-05       --------------------------------------------------
Q64373_BCL2L1-03       --------------------------------------------------
Q64373_BCL2L1-04       --------------------------------------------------
O35843_BCL2L1-01       --------------------------------------------------
Q5HZH3_BCL2L1-02       --------------------------------------------------
Q64373_BCL2L1-01       --------------------------------------------------
Q64373_BCL2L1-09       --------------------------------------------------
                                                                         

P70345_BCL2L2-03       --------------------------------------------------
Q64373_BCL2L1-07       --------------------------------------------------
Q64373_BCL2L1-08       --------------------------------------------------
D3Z5F7_BCL2L2-01       TNRPGISTTDRGFPRSRYRARTTNYNSSRSRFYSGFNSRPRGRIYRGRAR
P97287_MCL1-02         --------------------------------------------------
P97287_MCL1-01         --------------------------------------------------
O55178_BCL2A1-01       --------------------------------------------------
Q0P538_BCL2A1-01       --------------------------------------------------
Q07440_BCL2A1-01       --------------------------------------------------
O55179_BCL2A1-01       --------------------------------------------------
O55177_BCL2A1-02       --------------------------------------------------
Q497M6_BCL2A1-01       --------------------------------------------------
Q8K164_BCL2A1-01       --------------------------------------------------
Q4FK02_BCL2A1-01       --------------------------------------------------
Q9Z0F3_BCL2L10-01      --------------------------------------------------
P70345_BCL2L2-05       --------------------------------------------------
P70345_BCL2L2-01       --------------------------------------------------
P70345_BCL2L2-04       --------------------------------------------------
P10417_BCL2-01         --------------------------------------------------
P10417_BCL2-02         --------------------------------------------------
Q6NTH7_BCL2-01         --------------------------------------------------
Q64373_BCL2L1-06       --------------------------------------------------
Q64373_BCL2L1-05       --------------------------------------------------
Q64373_BCL2L1-03       --------------------------------------------------
Q64373_BCL2L1-04       --------------------------------------------------
O35843_BCL2L1-01       --------------------------------------------------
Q5HZH3_BCL2L1-02       --------------------------------------------------
Q64373_BCL2L1-01       --------------------------------------------------
Q64373_BCL2L1-09       --------------------------------------------------
                                                                         

P70345_BCL2L2-03       --------
Q64373_BCL2L1-07       --------
Q64373_BCL2L1-08       --------
D3Z5F7_BCL2L2-01       ATSWYSPY
P97287_MCL1-02         --------
P97287_MCL1-01         --------
O55178_BCL2A1-01       --------
Q0P538_BCL2A1-01       --------
Q07440_BCL2A1-01       --------
O55179_BCL2A1-01       --------
O55177_BCL2A1-02       --------
Q497M6_BCL2A1-01       --------
Q8K164_BCL2A1-01       --------
Q4FK02_BCL2A1-01       --------
Q9Z0F3_BCL2L10-01      --------
P70345_BCL2L2-05       --------
P70345_BCL2L2-01       --------
P70345_BCL2L2-04       --------
P10417_BCL2-01         --------
P10417_BCL2-02         --------
Q6NTH7_BCL2-01         --------
Q64373_BCL2L1-06       --------
Q64373_BCL2L1-05       --------
Q64373_BCL2L1-03       --------
Q64373_BCL2L1-04       --------
O35843_BCL2L1-01       --------
Q5HZH3_BCL2L1-02       --------
Q64373_BCL2L1-01       --------
Q64373_BCL2L1-09       --------
                               

© 1998-2022Legal notice