Dataset for protein BCL-2-like of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

16 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P70345_BCL2L2-02       --------------------------------------------------
P97287_MCL1-01         MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAAL
O55178_BCL2A1-01       --------------------------------------------------
Q0P538_BCL2A1-01       --------------------------------------------------
Q07440_BCL2A1-01       --------------------------------------------------
O55179_BCL2A1-01       --------------------------------------------------
O55177_BCL2A1-02       --------------------------------------------------
Q497M6_BCL2A1-01       --------------------------------------------------
Q8K164_BCL2A1-01       --------------------------------------------------
Q4FK02_BCL2A1-01       --------------------------------------------------
Q9Z0F3_BCL2L10-01      --------------------------------------------------
P70345_BCL2L2-01       --------------------------------------------------
P10417_BCL2-01         --------------------------------------------------
O35843_BCL2L1-01       --------------------------------------------------
Q64373_BCL2L1-09       --------------------------------------------------
Q64373_BCL2L1-01       --------------------------------------------------
                                                                         

P70345_BCL2L2-02       --------------------------------------------------
P97287_MCL1-01         LPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAI
O55178_BCL2A1-01       --------------------------------------------------
Q0P538_BCL2A1-01       --------------------------------------------------
Q07440_BCL2A1-01       --------------------------------------------------
O55179_BCL2A1-01       --------------------------------------------------
O55177_BCL2A1-02       --------------------------------------------------
Q497M6_BCL2A1-01       --------------------------------------------------
Q8K164_BCL2A1-01       --------------------------------------------------
Q4FK02_BCL2A1-01       --------------------------------------------------
Q9Z0F3_BCL2L10-01      --------------------------------------------------
P70345_BCL2L2-01       --------------------------------------------------
P10417_BCL2-01         --------------------------------------------------
O35843_BCL2L1-01       --------------------------------------------------
Q64373_BCL2L1-09       --------------------------------------------------
Q64373_BCL2L1-01       --------------------------------------------------
                                                                         

P70345_BCL2L2-02       --------------------------------------------------
P97287_MCL1-01         VSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEE
O55178_BCL2A1-01       --------MAEYELMHIHSLAEHYLQYVLQVPAFESAPSQ----------
Q0P538_BCL2A1-01       --------MAEYELMHIHSLAEHYLQYVLQVPAFESAPSQ----------
Q07440_BCL2A1-01       --------MAESELMHIHSLAEHYLQYVLQVPAFESAPSQ----------
O55179_BCL2A1-01       --------MSEYEFMYIHSLAEHYLQYVLQVPAFESAPSQ----------
O55177_BCL2A1-02       --------MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSQ----------
Q497M6_BCL2A1-01       --------MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSK----------
Q8K164_BCL2A1-01       --------MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSQ----------
Q4FK02_BCL2A1-01       --------MSEYEFMYIHSLAEHYLQYVLQVPAFESAPSK----------
Q9Z0F3_BCL2L10-01      -----MADSQDPLHERTRRLLSDYIFF---------------------CA
P70345_BCL2L2-01       -------MATPASTPDTRALVADFVGYKLRQKGY----------------
P10417_BCL2-01         ------MAQAGRTGYDNREIVMKYIHYKLSQRGYEW--------DAGDAD
O35843_BCL2L1-01       ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAP
Q64373_BCL2L1-09       ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAP
Q64373_BCL2L1-01       ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAP
                                                                         

P70345_BCL2L2-02       --------------------------------------------------
P97287_MCL1-01         EEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRR-----------
O55178_BCL2A1-01       --------------------------------------------------
Q0P538_BCL2A1-01       --------------------------------------------------
Q07440_BCL2A1-01       --------------------------------------------------
O55179_BCL2A1-01       --------------------------------------------------
O55177_BCL2A1-02       --------------------------------------------------
Q497M6_BCL2A1-01       --------------------------------------------------
Q8K164_BCL2A1-01       --------------------------------------------------
Q4FK02_BCL2A1-01       --------------------------------------------------
Q9Z0F3_BCL2L10-01      REPDTPEPPPTSV-------------------------------------
P70345_BCL2L2-01       ------------------------------------------VCGAGPGE
P10417_BCL2-01         AAPLGAAPTPGIFSFQPESN--PMPAVHRDMAARTS-PLRPLVATAGPAL
O35843_BCL2L1-01       EETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAA---
Q64373_BCL2L1-09       EETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAA---
Q64373_BCL2L1-01       EETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAA---
                                                                         

P70345_BCL2L2-02       --------------------------------------------------
P97287_MCL1-01         ------ALETLRRVGDGVQRNHETAFQGMLRKLDIKN-EGDVKSFSRVMV
O55178_BCL2A1-01       ------AFRVLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVME
Q0P538_BCL2A1-01       ------AFRVLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVME
Q07440_BCL2A1-01       ------ACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVME
O55179_BCL2A1-01       ------ACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVME
O55177_BCL2A1-02       ------ACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVME
Q497M6_BCL2A1-01       ------ACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVME
Q8K164_BCL2A1-01       ------ACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVME
Q4FK02_BCL2A1-01       ------ACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVME
Q9Z0F3_BCL2L10-01      ------EAALLRSVTRQIQQEHQEFFSSFCE----SR-GNRLELVKQMAD
P70345_BCL2L2-01       GPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSD
P10417_BCL2-01         SPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP-FTARGRFATVVE
O35843_BCL2L1-01       ------VKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVN
Q64373_BCL2L1-09       ------VKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVN
Q64373_BCL2L1-01       ------VKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVN
                                                                         

P70345_BCL2L2-02       ---MEPLV----------------------------------------GQ
P97287_MCL1-01         HVFKDGVT-NWGRIVTLISFGAFV--------AKHLKSVNQESFI---EP
O55178_BCL2A1-01       KEFEDGII-NWGRIVTIFAFGGVL--------LKKTSTRADCPGC-----
Q0P538_BCL2A1-01       KEFENGII-NWGRIVTIFAFGGVL--------LKKTSTRADCPGC-----
Q07440_BCL2A1-01       KEFEDGII-NWGRIVTIFAFGGVL--------LKKLPQEQIALDVCAYKQ
O55179_BCL2A1-01       KEFEDGII-NWGRIVTIFAFGGVL--------LKKLPQEQIALDVGAYKQ
O55177_BCL2A1-02       KEFEDGII-NWGRIVTIFAFGGVL--------LKKLPQEQIALDVGAYKQ
Q497M6_BCL2A1-01       KEFEDGII-NWGRIVTIFAFGGVL--------LKKLPQEQIALDVGAYKQ
Q8K164_BCL2A1-01       KEFEDGII-NWGRIVTIFAFGGVL--------LKKLPQEQIALDVGAYKQ
Q4FK02_BCL2A1-01       KEFEDGII-NWGRIVTIFAFGGVL--------LKKLPQEQIALDVGAYKQ
Q9Z0F3_BCL2L10-01      KLLSKDQDFSWSQLVMLLAFAGTLMNQGPYMAVKQKRDLGNRVIV---TR
P70345_BCL2L2-01       ELFQGGPN--WGRLVAFFVFGAAL--------CAESVNKEMEPLV---GQ
P10417_BCL2-01         ELFRDGVN--WGRIVAFFEFGGVM--------CVESVNREMSPLV---DN
O35843_BCL2L1-01       ELFRDGVN--WGRIVAFFSFGGAL--------CVESVDKEMQVLV---SR
Q64373_BCL2L1-09       ELFRDGVN--WGRIVAFFSFGGAL--------CVESVDKEMQVLV---SR
Q64373_BCL2L1-01       ELFRDGVN--WGRIVAFFSFGGAL--------CVESVDKEMQVLV---SR
                                                                         

P70345_BCL2L2-02       VQDWMVAYLETRL-----ADWIHSSGGW-AEFTALYGDGAL-------EE
P97287_MCL1-01         LAETITDVLVRTK-----RDWLVKQRGW-DGFVEFFHVQDLEGGIR----
O55178_BCL2A1-01       --------------------------------------------------
Q0P538_BCL2A1-01       --------------------------------------------------
Q07440_BCL2A1-01       VSSFVAEFIMNNT-----GEWIRQNGGWEDGFIKKFEPK-----------
O55179_BCL2A1-01       VSSFVAEFIMNNT-----GEWIRRNGGWEDGFIKKFEPK-----------
O55177_BCL2A1-02       VSSFVAEFIINNT-----GEWIRRNGGWEDGFIKKFEPK-----------
Q497M6_BCL2A1-01       VSSFVAEFIINNT-----GEWIRRNGGWEDGFIKKFEPK-----------
Q8K164_BCL2A1-01       VSSFVAEFIINNT-----GEWIRRNGGWEDGFIKKFEPK-----------
Q4FK02_BCL2A1-01       VSSFVAEFIINNT-----GEWIRRNGGWEDGFIKKFEPK-----------
Q9Z0F3_BCL2L10-01      DCCLIVNFLYNLLMGRRHRARLEALGGW-DGFCRFFKNPLPLGFW-----
P70345_BCL2L2-01       VQDWMVAYLETRL-----ADWIHSSGGW-AEFTALYGDGAL-------EE
P10417_BCL2-01         IALWMTEYLNRHL-----HTWIQDNGGW-DAFVELYG-----------PS
O35843_BCL2L1-01       IASWMATYLNDHL-----EPWIQENGGW-GV--------------SGGTP
Q64373_BCL2L1-09       IASWMATYLNDHL-----EPWIQENGGW-DTFVDLYGNNAAAESRKGQER
Q64373_BCL2L1-01       IASWMATYLNDHL-----EPWIQENGGW-DTFVDLYGNNAAAESRKGQER
                                                                         

P70345_BCL2L2-02       ARRLREGNWASVRTVLTGAVALGALVTVGAFFASK-------------
P97287_MCL1-01         ------------------NVLLAFAGVAGVGAGLAYLIR---------
O55178_BCL2A1-01       ----------------------TCLQTSFQFWGRIHNE----------
Q0P538_BCL2A1-01       ----------------------TCLQTSFQFWGRIHHE----------
Q07440_BCL2A1-01       ------------------SGWLTFLQMTGQIWEMLFLLK---------
O55179_BCL2A1-01       ------------------SGWLTFLQMTGQIWEMLFLLK---------
O55177_BCL2A1-02       ------------------SGWLTFLQMTGQFWEMLFLLK---------
Q497M6_BCL2A1-01       ------------------SGWLTFLQMTGQFWEMLFLLK---------
Q8K164_BCL2A1-01       ------------------SGWLTFLQMTGQIWEMLFLLK---------
Q4FK02_BCL2A1-01       ------------------SGWLTFLQMTGQFWEMLFLLK---------
Q9Z0F3_BCL2L10-01      ------------RRLLI-QAFLSGFFATAIFFIWKRL-----------
P70345_BCL2L2-01       ARRLREGNWASVRTVLTGAVALGALVTVGAFFASK-------------
P10417_BCL2-01         MRPLFDFSWLSLKTLLS-LALVGACITLGAYLGHK-------------
O35843_BCL2L1-01       LRSVF-------RRLVQ-VPGVAEHVCDPSLWEVETEGSEVQGPPQLL
Q64373_BCL2L1-09       FNRWF-------LTGMT-VAGV---VLLGSLFSRK-------------
Q64373_BCL2L1-01       FNRWF-------LTGMT-VAGV---VLLGSLFSRK-------------
                                                                       

© 1998-2020Legal notice