Dataset for protein BCL-2-like of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


D3Z5F7_BCL2L2-01      ----MATPASTPDTRALVADFVGYKLRQKGYVCGAG--------------
O35843_BCL2L1-01      -----MSQSN----RELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEET
Q5HZH3_BCL2L1-02      -----MSQSN----RELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEET
Q6NTH7_BCL2-01        MAQAGRTGYD---NREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPG
O55178_BCL2A1-01      -----MAEYELMHIHSLAEHYLQYVLQV----------------------
Q0P538_BCL2A1-01      -----MAEYELMHIHSLAEHYLQYVLQV----------------------
O55179_BCL2A1-01      -----MSEYEFMYIHSLAEHYLQYVLQV----------------------
O55177_BCL2A1-02      -----MAEYEFMYIHSLAEHYLQYVLQV----------------------
Q497M6_BCL2A1-01      -----MAEYEFMYIHSLAEHYLQYVLQV----------------------
Q8K164_BCL2A1-01      -----MAEYEFMYIHSLAEHYLQYVLQV----------------------
Q4FK02_BCL2A1-01      -----MSEYEFMYIHSLAEHYLQYVLQV----------------------
                            :  .    . :.  :: * *                        

D3Z5F7_BCL2L2-01      ---------------------------------PGEGPAADPLH------
O35843_BCL2L1-01      EAERETPSAINGNPSWHLADS------------PAVNGATGHSSSLDARE
Q5HZH3_BCL2L1-02      EAERETPSAINGNPSWHLADS------------PAVNGATGHSSSLDARE
Q6NTH7_BCL2-01        IFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVH------
O55178_BCL2A1-01      ---------------------------------PAFESAPSQAF------
Q0P538_BCL2A1-01      ---------------------------------PAFESAPSQAF------
O55179_BCL2A1-01      ---------------------------------PAFESAPSQAC------
O55177_BCL2A1-02      ---------------------------------PAFESAPSQAC------
Q497M6_BCL2A1-01      ---------------------------------PAFESAPSKAC------
Q8K164_BCL2A1-01      ---------------------------------PAFESAPSQAC------
Q4FK02_BCL2A1-01      ---------------------------------PAFESAPSKAC------
                                                       *.   ..          

D3Z5F7_BCL2L2-01      --------QAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSD
O35843_BCL2L1-01      VIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVN
Q5HZH3_BCL2L1-02      VIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVN
Q6NTH7_BCL2-01        --------LTLRRAGDDFSRRYRRDFAEMSSQLHLTPF-TARGRFATVVE
O55178_BCL2A1-01      --------RVLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVME
Q0P538_BCL2A1-01      --------RVLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVME
O55179_BCL2A1-01      --------RVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVME
O55177_BCL2A1-02      --------RVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVME
Q497M6_BCL2A1-01      --------RVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVME
Q8K164_BCL2A1-01      --------RVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVME
Q4FK02_BCL2A1-01      --------RVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVME
                               .:. .. ...    . : .   ::*: .  ::   *  * :

D3Z5F7_BCL2L2-01      ELFQGG-PNWGRLVAFFVFGAALCAESVNKEMEPLV---GQVQDWMVAYL
O35843_BCL2L1-01      ELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQVLV---SRIASWMATYL
Q5HZH3_BCL2L1-02      ELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQVLV---SRIASWMATYL
Q6NTH7_BCL2-01        ELFRDG-VNWGRIVAFFEFGGVMCVESVNREMSPLV---DNIALWMTEYL
O55178_BCL2A1-01      KEFEDGIINWGRIVTIFAFGGVLLKKTSTRADCPGC--------------
Q0P538_BCL2A1-01      KEFENGIINWGRIVTIFAFGGVLLKKTSTRADCPGC--------------
O55179_BCL2A1-01      KEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFI
O55177_BCL2A1-02      KEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFI
Q497M6_BCL2A1-01      KEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFI
Q8K164_BCL2A1-01      KEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFI
Q4FK02_BCL2A1-01      KEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFI
                      : * .*  ****:*::* **..:  :                        

D3Z5F7_BCL2L2-01      ETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPP
O35843_BCL2L1-01      NDHLEPWIQENGGWGV--------------SGGTPLRSVFRRLVQVP---
Q5HZH3_BCL2L1-02      NDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVA---
Q6NTH7_BCL2-01        NRHLHTWIQDNGGWVG------------ACLVE-----------------
O55178_BCL2A1-01      -----------------------------------------TCLQTS---
Q0P538_BCL2A1-01      -----------------------------------------TCLQTS---
O55179_BCL2A1-01      MNNTGEWIRRNGGWED------------GFIKKFEPKSGWLTFLQMT---
O55177_BCL2A1-02      INNTGEWIRRNGGWED------------GFIKKFEPKSGWLTFLQMT---
Q497M6_BCL2A1-01      INNTGEWIRRNGGWED------------GFIKKFEPKSGWLTFLQMT---
Q8K164_BCL2A1-01      INNTGEWIRRNGGWED------------GFIKKFEPKSGWLTFLQMT---
Q4FK02_BCL2A1-01      INNTGEWIRRNGGWED------------GFIKKFEPKSGWLTFLQMT---
                                                                        

D3Z5F7_BCL2L2-01      GNAGPVIMSLEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTI
O35843_BCL2L1-01      --------------------------------------------------
Q5HZH3_BCL2L1-02      --------------------------------------------------
Q6NTH7_BCL2-01        --------------------------------------------------
O55178_BCL2A1-01      --------------------------------------------------
Q0P538_BCL2A1-01      --------------------------------------------------
O55179_BCL2A1-01      --------------------------------------------------
O55177_BCL2A1-02      --------------------------------------------------
Q497M6_BCL2A1-01      --------------------------------------------------
Q8K164_BCL2A1-01      --------------------------------------------------
Q4FK02_BCL2A1-01      --------------------------------------------------
                                                                        

D3Z5F7_BCL2L2-01      LCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPG
O35843_BCL2L1-01      --------------------------------------------------
Q5HZH3_BCL2L1-02      --------------------------------------------------
Q6NTH7_BCL2-01        --------------------------------------------------
O55178_BCL2A1-01      --------------------------------------------------
Q0P538_BCL2A1-01      --------------------------------------------------
O55179_BCL2A1-01      --------------------------------------------------
O55177_BCL2A1-02      --------------------------------------------------
Q497M6_BCL2A1-01      --------------------------------------------------
Q8K164_BCL2A1-01      --------------------------------------------------
Q4FK02_BCL2A1-01      --------------------------------------------------
                                                                        

D3Z5F7_BCL2L2-01      ISTTDRGFPRSRYRARTTNYNSSRSRFYSGFNSRPRGRIYRGRARATSWY
O35843_BCL2L1-01      -----------------------------------------GVAEHVCDP
Q5HZH3_BCL2L1-02      -----------------------------------------GV---VLLG
Q6NTH7_BCL2-01        --------------------------------------------------
O55178_BCL2A1-01      -----------------------------------------F----QFWG
Q0P538_BCL2A1-01      -----------------------------------------F----QFWG
O55179_BCL2A1-01      -----------------------------------------G----QIWE
O55177_BCL2A1-02      -----------------------------------------G----QFWE
Q497M6_BCL2A1-01      -----------------------------------------G----QFWE
Q8K164_BCL2A1-01      -----------------------------------------G----QIWE
Q4FK02_BCL2A1-01      -----------------------------------------G----QFWE
                                                                        

D3Z5F7_BCL2L2-01      SPY----------------
O35843_BCL2L1-01      SLWEVETEGSEVQGPPQLL
Q5HZH3_BCL2L1-02      SLFSRK-------------
Q6NTH7_BCL2-01        -------------------
O55178_BCL2A1-01      RIHNE--------------
Q0P538_BCL2A1-01      RIHHE--------------
O55179_BCL2A1-01      MLFLLK-------------
O55177_BCL2A1-02      MLFLLK-------------
Q497M6_BCL2A1-01      MLFLLK-------------
Q8K164_BCL2A1-01      MLFLLK-------------
Q4FK02_BCL2A1-01      MLFLLK-------------
                                         

© 1998-2023Legal notice