Dataset for protein BCL-2-like of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

25 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P97287_MCL1-01         MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAAL
P97287_MCL1-02         MFGLRRNAVIGLNLYCG---------------------------------
O55178_BCL2A1-01       --------------------------------------------------
Q07440_BCL2A1-01       --------------------------------------------------
O55177_BCL2A1-02       --------------------------------------------------
Q8K164_BCL2A1-01       --------------------------------------------------
Q4FK02_BCL2A1-01       --------------------------------------------------
P70345_BCL2L2-02       --------------------------------------------------
Q9Z0F3_BCL2L10-01      --------------------------------------------------
P70345_BCL2L2-04       --------------------------------------------------
P70345_BCL2L2-03       --------------------------------------------------
P70345_BCL2L2-01       --------------------------------------------------
P10417_BCL2-01         --------------------------------------------------
P10417_BCL2-02         --------------------------------------------------
Q6NTH7_BCL2-01         --------------------------------------------------
Q64373_BCL2L1-07       --------------------------------------------------
Q64373_BCL2L1-08       --------------------------------------------------
Q64373_BCL2L1-06       --------------------------------------------------
Q64373_BCL2L1-05       --------------------------------------------------
Q64373_BCL2L1-03       --------------------------------------------------
Q64373_BCL2L1-04       --------------------------------------------------
O35843_BCL2L1-01       --------------------------------------------------
Q5HZH3_BCL2L1-02       --------------------------------------------------
Q64373_BCL2L1-01       --------------------------------------------------
Q64373_BCL2L1-09       --------------------------------------------------
                                                                         

P97287_MCL1-01         LPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAI
P97287_MCL1-02         -------------GAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAI
O55178_BCL2A1-01       --------------------------------------------------
Q07440_BCL2A1-01       --------------------------------------------------
O55177_BCL2A1-02       --------------------------------------------------
Q8K164_BCL2A1-01       --------------------------------------------------
Q4FK02_BCL2A1-01       --------------------------------------------------
P70345_BCL2L2-02       --------------------------------------------------
Q9Z0F3_BCL2L10-01      --------------------------------------------------
P70345_BCL2L2-04       --------------------------------------------------
P70345_BCL2L2-03       --------------------------------------------------
P70345_BCL2L2-01       --------------------------------------------------
P10417_BCL2-01         --------------------------------------------------
P10417_BCL2-02         --------------------------------------------------
Q6NTH7_BCL2-01         --------------------------------------------------
Q64373_BCL2L1-07       --------------------------------------------------
Q64373_BCL2L1-08       --------------------------------------------------
Q64373_BCL2L1-06       --------------------------------------------------
Q64373_BCL2L1-05       --------------------------------------------------
Q64373_BCL2L1-03       --------------------------------------------------
Q64373_BCL2L1-04       --------------------------------------------------
O35843_BCL2L1-01       --------------------------------------------------
Q5HZH3_BCL2L1-02       --------------------------------------------------
Q64373_BCL2L1-01       --------------------------------------------------
Q64373_BCL2L1-09       --------------------------------------------------
                                                                         

P97287_MCL1-01         VSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEE
P97287_MCL1-02         VSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEE
O55178_BCL2A1-01       --------MAEYELMHIHSLAEHYLQYVLQVPAFESAPSQ----------
Q07440_BCL2A1-01       --------MAESELMHIHSLAEHYLQYVLQVPAFESAPSQ----------
O55177_BCL2A1-02       --------MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSQ----------
Q8K164_BCL2A1-01       --------MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSQ----------
Q4FK02_BCL2A1-01       --------MSEYEFMYIHSLAEHYLQYVLQVPAFESAPSK----------
P70345_BCL2L2-02       --------------------------------------------------
Q9Z0F3_BCL2L10-01      -----MADSQDPLHERTRRLLSDYIFF---------------------CA
P70345_BCL2L2-04       -------MATPASTPDTRALVADFVGYKLRQKGY----------------
P70345_BCL2L2-03       -------MATPASTPDTRALVADFVGYKLRQKGY----------------
P70345_BCL2L2-01       -------MATPASTPDTRALVADFVGYKLRQKGY----------------
P10417_BCL2-01         ------MAQAGRTGYDNREIVMKYIHYKLSQRGYEW--------DAGDAD
P10417_BCL2-02         ------MAQAGRTGYDNREIVMKYIHYKLSQRGYEW--------DAGDAD
Q6NTH7_BCL2-01         ------MAQAGRTGYDNREIVMKYIHYKLSQRGYEW--------DAGDAD
Q64373_BCL2L1-07       ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAP
Q64373_BCL2L1-08       ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAP
Q64373_BCL2L1-06       ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAP
Q64373_BCL2L1-05       ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAP
Q64373_BCL2L1-03       ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAP
Q64373_BCL2L1-04       ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAP
O35843_BCL2L1-01       ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAP
Q5HZH3_BCL2L1-02       ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAP
Q64373_BCL2L1-01       ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAP
Q64373_BCL2L1-09       ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAP
                                                                         

P97287_MCL1-01         EEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRR-----------
P97287_MCL1-02         EEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRR-----------
O55178_BCL2A1-01       --------------------------------------------------
Q07440_BCL2A1-01       --------------------------------------------------
O55177_BCL2A1-02       --------------------------------------------------
Q8K164_BCL2A1-01       --------------------------------------------------
Q4FK02_BCL2A1-01       --------------------------------------------------
P70345_BCL2L2-02       --------------------------------------------------
Q9Z0F3_BCL2L10-01      REPDTPEPPPTSV-------------------------------------
P70345_BCL2L2-04       -----------VCGAGPGEGPAADP-------------------------
P70345_BCL2L2-03       -----------VCGAGPGEGPAADP-------------------------
P70345_BCL2L2-01       -----------VCGAGPGEGPAADP-------------------------
P10417_BCL2-01         AAPLGAAPTPGIFSFQPESN--PMPAVHRDMAARTS-PLRPLVATAGPAL
P10417_BCL2-02         AAPLGAAPTPGIFSFQPESN--PMPAVHRDMAARTS-PLRPLVATAGPAL
Q6NTH7_BCL2-01         AAPLGAAPTPGIFSFQPESN--PMPAVHRDMAARTS-PLRPLVATAGPAL
Q64373_BCL2L1-07       EETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAA---
Q64373_BCL2L1-08       EETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAR----------
Q64373_BCL2L1-06       EETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAA---
Q64373_BCL2L1-05       EETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAA---
Q64373_BCL2L1-03       EETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAA---
Q64373_BCL2L1-04       EETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAA---
O35843_BCL2L1-01       EETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAA---
Q5HZH3_BCL2L1-02       EETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAA---
Q64373_BCL2L1-01       EETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAA---
Q64373_BCL2L1-09       EETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAA---
                                                                         

P97287_MCL1-01         ------ALETLRRVGDGVQRNHETAFQGMLRKLDIKN-EGDVKSFSRVMV
P97287_MCL1-02         ------ALETLRRVGDGVQRNHETAFQGMLRKLDIKN-EGDVKSFSRVMV
O55178_BCL2A1-01       ------AFRVLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVME
Q07440_BCL2A1-01       ------ACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVME
O55177_BCL2A1-02       ------ACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVME
Q8K164_BCL2A1-01       ------ACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVME
Q4FK02_BCL2A1-01       ------ACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVME
P70345_BCL2L2-02       --------------------------------------------------
Q9Z0F3_BCL2L10-01      ------EAALLRSVTRQIQQEHQEFFSSFCE----SR-GNRLELVKQMAD
P70345_BCL2L2-04       ------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSD
P70345_BCL2L2-03       ------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSD
P70345_BCL2L2-01       ------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSD
P10417_BCL2-01         SPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP-FTARGRFATVVE
P10417_BCL2-02         SPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP-FTARGRFATVVE
Q6NTH7_BCL2-01         SPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP-FTARGRFATVVE
Q64373_BCL2L1-07       ------VKQALREAGDE---------------------------------
Q64373_BCL2L1-08       --------------------------------------------------
Q64373_BCL2L1-06       ------VKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVN
Q64373_BCL2L1-05       ------VKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVN
Q64373_BCL2L1-03       ------VKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVN
Q64373_BCL2L1-04       ------VKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVN
O35843_BCL2L1-01       ------VKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVN
Q5HZH3_BCL2L1-02       ------VKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVN
Q64373_BCL2L1-01       ------VKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVN
Q64373_BCL2L1-09       ------VKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVN
                                                                         

P97287_MCL1-01         HVFKDGVT-NWGRIVTLISFGAFV--------AKHLKSVNQESFI---EP
P97287_MCL1-02         HVFKDGVT-NWGRIVTLISFGAFV--------AKHLKSVNQESFI---EP
O55178_BCL2A1-01       KEFEDGII-NWGRIVTIFAFGGVL--------LKKTSTRADCPGC-----
Q07440_BCL2A1-01       KEFEDGII-NWGRIVTIFAFGGVL--------LKKLPQEQIALDVCAYKQ
O55177_BCL2A1-02       KEFEDGII-NWGRIVTIFAFGGVL--------LKKLPQEQIALDVGAYKQ
Q8K164_BCL2A1-01       KEFEDGII-NWGRIVTIFAFGGVL--------LKKLPQEQIALDVGAYKQ
Q4FK02_BCL2A1-01       KEFEDGII-NWGRIVTIFAFGGVL--------LKKLPQEQIALDVGAYKQ
P70345_BCL2L2-02       ----------------------------------------MEPLV---GQ
Q9Z0F3_BCL2L10-01      KLLSKDQDFSWSQLVMLLAFAGTLMNQGPYMAVKQKRDLGNRVIV---TR
P70345_BCL2L2-04       ELFQGGPN--WGRLVAFFVFGAAL--------CAESVNKEMEP-------
P70345_BCL2L2-03       ELFQGGPN--WGRLVAFFVFGAAL--------CAESVNKEMEPLV---GQ
P70345_BCL2L2-01       ELFQGGPN--WGRLVAFFVFGAAL--------CAESVNKEMEPLV---GQ
P10417_BCL2-01         ELFRDGVN--WGRIVAFFEFGGVM--------CVESVNREMSPLV---DN
P10417_BCL2-02         ELFRDGVN--WGRIVAFFEFGGVM--------CVESVNREMSPLV---DN
Q6NTH7_BCL2-01         ELFRDGVN--WGRIVAFFEFGGVM--------CVESVNREMSPLV---DN
Q64373_BCL2L1-07       --------------------------------------------------
Q64373_BCL2L1-08       --------------------------------------------------
Q64373_BCL2L1-06       ELFRDGVN--WGRIVAFFSFGGAL--------CVES--------------
Q64373_BCL2L1-05       ELFRDGVN--WGRIVAFFSFGGAL--------CVESVDKEMQVLV---SR
Q64373_BCL2L1-03       ELFRDGVN--WGRIVAFFSFGGAL--------CVESVDKEMQVLV---SR
Q64373_BCL2L1-04       ELFRDGVN--WGRIVAFFSFGGAL--------CVESVDKEMQVLV---SR
O35843_BCL2L1-01       ELFRDGVN--WGRIVAFFSFGGAL--------CVESVDKEMQVLV---SR
Q5HZH3_BCL2L1-02       ELFRDGVN--WGRIVAFFSFGGAL--------CVESVDKEMQVLV---SR
Q64373_BCL2L1-01       ELFRDGVN--WGRIVAFFSFGGAL--------CVESVDKEMQVLV---SR
Q64373_BCL2L1-09       ELFRDGVN--WGRIVAFFSFGGAL--------CVESVDKEMQVLV---SR
                                                                         

P97287_MCL1-01         LAETITDVLVRTK-----RDWLVKQRGWDGFVEFFHVQDL----------
P97287_MCL1-02         LAETITDVLVRTK-----RDWLVKQRGWDGFVEFFHVQDL----------
O55178_BCL2A1-01       -------------------------------------------TCLQTSF
Q07440_BCL2A1-01       VSSFVAEFIMNNT-----GEWIRQNGGWEDGFIKKFEPKSGWLTFLQMTG
O55177_BCL2A1-02       VSSFVAEFIINNT-----GEWIRRNGGWEDGFIKKFEPKSGWLTFLQMTG
Q8K164_BCL2A1-01       VSSFVAEFIINNT-----GEWIRRNGGWEDGFIKKFEPKSGWLTFLQMTG
Q4FK02_BCL2A1-01       VSSFVAEFIINNT-----GEWIRRNGGWEDGFIKKFEPKSGWLTFLQMTG
P70345_BCL2L2-02       VQDWMVAYLETRL-----ADWIHSSGGWAEFTALYGDGALEEARRLREGN
Q9Z0F3_BCL2L10-01      DCCLIVNFLYNLLMGRRHRARLEALGGWDGFCRFFKNPLP----------
P70345_BCL2L2-04       --------------------------------------------------
P70345_BCL2L2-03       VQDWMVAYLETRL-----ADWIHSSGGWVRSSQLLLSASL-----YKVGL
P70345_BCL2L2-01       VQDWMVAYLETRL-----ADWIHSSGGWAEFTALYGDGALEEARRLREGN
P10417_BCL2-01         IALWMTEYLNRHL-----HTWIQDNGGWDAFVELYGPSMRPLFDFSWLSL
P10417_BCL2-02         IALWMTEYLNRHL-----HTWIQDNGGW----------------------
Q6NTH7_BCL2-01         IALWMTEYLNRHL-----HTWIQDNGGW----------------------
Q64373_BCL2L1-07       --------------------------------------------------
Q64373_BCL2L1-08       --------------------------------------------------
Q64373_BCL2L1-06       --------------------------------------------------
Q64373_BCL2L1-05       IASWMATYLNDHL-----EPWIQENGGW----------------------
Q64373_BCL2L1-03       IASWMATYLNDHL-----EPWIQENGGWVR--------------------
Q64373_BCL2L1-04       IASWMATYLNDHL-----EPWIQENGGWVR--------------------
O35843_BCL2L1-01       IASWMATYLNDHL-----EPWIQENGGWGV--------------SGGTPL
Q5HZH3_BCL2L1-02       IASWMATYLNDHL-----EPWIQENGGWDTFVDLYGNNAAAESRKGQERF
Q64373_BCL2L1-01       IASWMATYLNDHL-----EPWIQENGGWDTFVDLYGNNAAAESRKGQERF
Q64373_BCL2L1-09       IASWMATYLNDHL-----EPWIQENGGWDTFVDLYGNNAAAESRKGQERF
                                                                         

P97287_MCL1-01         EGGIRNVLLAFAGVAGVGAGLAYLIR-------------
P97287_MCL1-02         EGGIRNVLLAFAGVAGVGAGLAYLIR-------------
O55178_BCL2A1-01       QFWGRIHNE------------------------------
Q07440_BCL2A1-01       QIWEMLFLLK-----------------------------
O55177_BCL2A1-02       QFWEMLFLLK-----------------------------
Q8K164_BCL2A1-01       QIWEMLFLLK-----------------------------
Q4FK02_BCL2A1-01       QFWEMLFLLK-----------------------------
P70345_BCL2L2-02       WASVRTVLTGAVALGALVTVGAFFASK------------
Q9Z0F3_BCL2L10-01      LGFWRRLLIQAFLSGFFATAIFFIWKRL-----------
P70345_BCL2L2-04       ---------------------------------------
P70345_BCL2L2-03       HGKIGPLMGGWGCAGKG----------------------
P70345_BCL2L2-01       WASVRTVLTGAVALGALVTVGAFFASK------------
P10417_BCL2-01         KTLLSLALVGACITLGAYLGHK-----------------
P10417_BCL2-02         --------VGACLVE------------------------
Q6NTH7_BCL2-01         --------VGACLVE------------------------
Q64373_BCL2L1-07       ---------------------------------------
Q64373_BCL2L1-08       ---------------------------------------
Q64373_BCL2L1-06       ---------------------------------------
Q64373_BCL2L1-05       ---------------------------------------
Q64373_BCL2L1-03       ----TTPLVCPPL---ACVSLLCEHP-------------
Q64373_BCL2L1-04       ----TTPLVCPPL---ACVSLLCEHP-------------
O35843_BCL2L1-01       RSVFRRLVQVPGVAEHVCDPSLWEVETEGSEVQGPPQLL
Q5HZH3_BCL2L1-02       NRWFLTGMTVAGV---VLLGSLFSRK-------------
Q64373_BCL2L1-01       NRWFLTGMTVAGV---VLLGSLFSRK-------------
Q64373_BCL2L1-09       NRWFLTGMTVAGV---VLLGSLFSRK-------------
                                                              

© 1998-2022Legal notice