Dataset for protein BCL-2-like of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfglrrnaviglnlycggaslgagggspagarlvaeeakarregggeaallpgarvvarpppvgaedpdvtasaerrlhk
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------msqs------nrelvvdflsyklsqkgyswsqfs--------apeeteaeretp
spgllavppeemaasaaaaivspeee--maeyetmdihsiaehyiqrv-qvpafe-----dveenrte------------
                         mlmatprtgyyt-aa-mklvh--sr-r---sapsqlpstdagdedaaplgaapsl
                          adgcgpsfphk p-lap--gf  -a-ks g dgk    ppppcer ddlyeqp 
                           a--dallig- -  l-  e   e a                 a    tp    
                            sq s aer  r  -   -                                  
                                 h       s   f                                  
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
saingnpswh-adspav--------s---r----------------vkqalrragdefelryrrafsdltsqlhitp-gt
----------l------ngatghss-lda-evipmaapalspvppvahrvmqevafsvqreveknlksylddf-vesid-
gifsfqlgenptpmkdshrdmaartagpl plvat g         lclt--a---d--k--------m----d--- -s
evcgag esga ad   kplge ga  rr                 ----  - tr-is-nhqtt ae-sak  lkn fg
tsv ry r q  g                                 elel  s   g  t fged qgfar    sr en
                                               fa       q  q    f    ce         
                                               a                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ayqsfeqvvnelfrdgvn--wgrivaffsfggal--------cvesvdkemqvlv---sriaswmatylndhl-----ep
-rir-n--meke-e--iifn---l-ti-a--av-mnqgpymalkkl-n--iep--gay-qv-----e------mgrrh--
d--iv-tm-d--l-gd-- s sq- --i- a--m        ----p-rq-aldic  k--slfvt-fiirnt     gd
tqg- tr s-hv qk pt       mllv   fv        aahtkqenq--fc   gnlqdtivav enrk     re
rvkl a  av   k  qd          e   t         v qkssvgnssi    dpdcel  d  vtt      ht
 le  s       s                                rtladr g    e   c   n  y l      aa
     k                                             c      t          m          
                                                                                
                                                                                

       330       340       350       360       370       380         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
                                                                     
wiqenggw-----------------------------ll------------------------------
--------ddfvilygnpalgeltflqetgqgwfrtv--gaglvggvllgslfsrkklgsevqgppqll
rlrssr  etgfekkfenksawsrkgrmrfnrsemlfmvvpcvleaactvlayeiste           
  hrq   vrstdffhvqdaeladrywtglwfgilrlvtkfvgaaklvvsgkclhrr            
  vdl   ag sa lldgsrp f sskvsneivvtngnqcwpatlhggapifwfap             
  ek    ge cr  kssmp    c glp ralwspp ia ais ffydah  iwe             
   q     v  q   pal           ltklgih gq fc    a      v              
   a     a                    ksfg  a e                              
                              h                                      
© 1998-2022Legal notice