Dataset for protein BCL-2-like of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfglrrnaviglnlycggaslgagggspagarlvaeeakarregggeaallpgarvvarpppvgaedpdvtasaerrlms
                                                            matp st  tr      mhm
                                                                              aa
                                                                               k
                                                                               d
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qs------nrelvvdflsykls---qkgy-w------------a--e-----etp-------------------pa----
maeyefmdihsiaehyvqavvqdwivpafs-sqfsdveenrte-pe-teaer---saingnpswhsvrtvlads--vnga
--grltyyteammakaigti-r   preeedgcepeaigdapdvdplplraapaagsfsfqgesn     stpmvpehrd
stpatlphp--wlms ahf- -   -e--lcaegtaly kggaclaalrgvs p kisgad nlp       gp  leee
apdpsgvs-qr  sa  a r a   h-sgv  a      e  g ar adtpe g t v      a        a   gal
 q lmsqpv d      f        s  g                    l                             
 m s agr         e                                                              
     veq                                                                        
     h                                                                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------a----------vkqalrragdefelryrrafsdllsqlhvtp-gtarqsfnqvv
ddlyrqsleiitghsssldarevipm-apglesapsqahrvmqevafsvqkeveknlksytddf-iesids-yii-e--m
           maarteqplgplvctpggaegpvapv-clt--a---d--r-f--t---maa--d--- --tq-rvttms
           srylrffatkskdag l easa gdpl---  - tr-istn-gt- ae---k  lkn fgd-g- -r -
           vtvga   s    sk         rrelel  s   g  - hqed qgfsr    sr enrvkl a  a
                                    k fa       q  q    f    ce          le  s   
                                      a                                     k   
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
eelfrdgvn--wgrivaffsfggal--------cvesvdkemqplv----qiaswmaeyln-hl-------wiq-nggw-
nke-eg-iifn---l-ti-a--av-mnqgpymalkklpneqievd-gaysrv---------n--mgrrhep---e----e
d--lq-d-- s sq- --iv a--m        -a---qr--al-ic  k--slfvttfiidnt     gerlrrsr  d
-hv -n pt       mll-   fv        a-hts--nq--gc   gnlqdtivav errk     rd  hsq   v
v   kk qp          e   t         v qkktvadssf    dpdcel  d  vtt      ht  vdl   g
    s   d                            rslgnc i    e   c   n  m l      aa  ek    a
                                          r      t          y             q     
                                                                          a     
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------l---------------------------------------------------
dfvikkfepksgwltflqmtgqfwemlf-lkaglvgnvllgslfsrkkmgsevrspyvlnvdygataeeleahfhgcggi
tgfelygnnaleesrkgwesfnrvfrtlmvgppvaekacvvlmcehptleadaqgipqgl                  sv
rstdffhvqdaalfdcyrtrlwisvlrgvtvwcptlhlytsikwlwere                               
gesr lrsssrp easslvgnrglgtipnecsvis ggvpphfsivs                                 
v cq alprmp  a rkklp ltkwsphhqq fcp ffgdaga fe                                  
l aa  kdglm    e gke ksflgkv nm  al a a      a                                  
e       ae           hneie q i                                                  
a                     a    a g                                                  

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
rnvllafagvagvgaglaylefsdkesirtslaldeslfrgrqikvipkrtnrpgisttdrgfprsryrarttnynssrs
nr tilcdkfs hpk f  i       v                                                    
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       490       500        
....:....|....:....|....:...
                            
----------------------------
rfysgfnsrprgriyrgraratswyspy
                            
                            
                            
                            
                            
                            
                            
© 1998-2022Legal notice