Dataset for protein BCL-2-like of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfglrrnaviglnlycggaslgagggspagarlvaeeakarregggeaallpgarvvarpppvgaedpdvtasaerrlhk
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------maeyefmyihslaehylqyvlqvpafesapsq--------------------
spgllavppeemaasaaaaivspeemmsqs------nre-vvdfis-k-sqkgysw----dveenrteapeeteaeretp
                         eld--pptlyht--i------r-s-------sqfslpstppppeerapdtyepsl
                          amstgsstpd- ralsplvhf  rarks g dgk    dagdcda dllpaqp 
                           agqdrlhirk p  mk  g   e a                 a    ga    
                            ac a geg  a  l   f                                  
                                 a       a   e                                  
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------acrvlqrvafsvqkeveknlksylddfhves-dt
saingnpswhladspavngatghsssldarevipmaapglspvppvvkqa-reagdefelryrrafsdltsql-itpig-
tivsrylrsqatpmkdskrlmeartagrr plvct g aeg aadp-h-tm--------r-hg-----m----d--- -s
gsf fq een  g    hpdga ga  pl    ag           lfl-  s trqis-n--tt qg-srk  lsr fn
e                                             e-el  a   g  t fqef aefce    kn eg
                                               la       d  q    d    aa         
                                               a                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ariifnqvmekefedgii-nWgriVtifaFggvl--------lkklpqeqialdv---kqvsswvaeflnnnl-----ge
tyqs-e--vnel-rnpvnf----l-af-s--aa-mnqgpymacvesvdkemqvlcgaysria-fmvtyiidhtmgrrhep
---rv-tm-d--lskdqv s sq- -ll- a--v        ---tstradepg-c  ----d----------     -d
rvk- tr s-hv qg pt       m-iv   tm        vaq--n---c--i   gplqltitav mtrk     r-
dqgl s  av   me ld          e   f         a hkr-vnq-si    tndcel  n  ert      at
 le  k       k                                kslgns f    e   c   d  y l      ha
     a                                             r      d          v          
                                                                                

       330       340       350       360       370       380       390        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
                                                                              
wirrnggw-dgfikkfepk-----------------------------sgwltflqmtgqfwemlfl-----------
--qe----e---v-lyg--alagsrkgqerfrrlfegnwasvrtlltgvagvga-vtlfslfgrk--lkevqgppqll
rl--sr   at -e---nnlalegws gteanswrdfs l llrvms -v----hilvpailssihnes         
  hsq    ge tdf kdgdpe fir  psm pv        k gvq a-l acfgvsavyaaweyhir         
  vql     v ca  hvq          pl               i qpa sgcfcd ig ivateg          
  ek      a  r    p                             n f  ea aa     l r            
   d                                            l              h              
   a                                                                          
© 1998-2020Legal notice