Dataset for protein Mcl-1 of organism Moschus moschiferus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6E5E6_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLVAGKEAAARREVGGG
A0A8C6E5E6_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLL---------------
                        ***********************************               

A0A8C6E5E6_MCL1-01      EAGTVIGGSAGPSPPATLGPDARRVARPSPIGAEGPDVTATPTRLLFFAP
A0A8C6E5E6_MCL1-02      --------------------------------------------------
                                                                          

A0A8C6E5E6_MCL1-01      TRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPPVRPLPLLVGEAS
A0A8C6E5E6_MCL1-02      --------------------------------------------------
                                                                          

A0A8C6E5E6_MCL1-01      NNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLG
A0A8C6E5E6_MCL1-02      ---------------------------------------ATGAKDAKPLG
                                                               ***********

A0A8C6E5E6_MCL1-01      GSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A8C6E5E6_MCL1-02      GSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
                        **************************************************

A0A8C6E5E6_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A8C6E5E6_MCL1-02      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
                        **************************************************

A0A8C6E5E6_MCL1-01      SKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A8C6E5E6_MCL1-02      SKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                        **************************************************

© 1998-2023Legal notice