Dataset for protein Mcl-1 of organism Moschus moschiferus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C6E5E6_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Moschus moschiferus GN=MCL-1 (length=196 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLATGAKDAKPLGGSGATSRKALETLRRVGDGVQRNHETAFQGMLRK
LDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDG
FVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C6E5E6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Moschus moschiferus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLVAGKEAAARREVGGGEAGTVIGGSAGPSPPATLGPDARRVARPSP
IGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPPVRPLPLLVGEASNNSPGSDGSL
PSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLGGSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2022Legal notice