Dataset for protein Bcl-xL of organism Microcebus murinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B7FNN3_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFIDAEENRTEAPEGTESEMETPSA
A0A8B7FNN3_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFIDAEENRTEAPEGTESEMETPSA
A0A8B7FNN3_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFIDAEENRTEAPEGTESEMETPSA
A0A8B7FNN3_BCL2L1-      ----------------------------------------MQKKIGLRPQ
                                                                 :.::   . 

A0A8B7FNN3_BCL2L1-      INGNPSWHLADSPPVNGATGHSSSLDAREVIPMAAVKQALKEAGDEFELR
A0A8B7FNN3_BCL2L1-      INGNPSWHLADSPPVNGATGHSSSLDAREVIPMAAVKQALKEAGDEFELR
A0A8B7FNN3_BCL2L1-      INGNPSWHLADSPPVNGATGHSSSLDAREVIPMAAVKQALKEAGDEFELR
A0A8B7FNN3_BCL2L1-      KGLNRRWR----PPVPLMATHP----------------------------
                         . *  *.    ***   : *.                            

A0A8B7FNN3_BCL2L1-      YRRAFSDLTSQLHITLATAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A8B7FNN3_BCL2L1-      YRRAFSDLTSQLHITLATAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A8B7FNN3_BCL2L1-      YRRAFSDLTSQLHITLATAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A8B7FNN3_BCL2L1-      ----------------ATAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                                        **********************************

A0A8B7FNN3_BCL2L1-      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A8B7FNN3_BCL2L1-      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A8B7FNN3_BCL2L1-      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A8B7FNN3_BCL2L1-      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
                        **************************************************

A0A8B7FNN3_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
A0A8B7FNN3_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
A0A8B7FNN3_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
A0A8B7FNN3_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                        *********************************

© 1998-2022Legal notice