Dataset for protein Bcl-xL of organism Microcebus murinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                         :.::   .  . *  *.    ***   : *.        
msqsnrelvvdflsyklsqkgyswsqfidaeenrteapegtesemetpsaingNpsWhladsPPVngatgHsssldarev
----------------------------------------mqkkiglrpqkgl rr r----   plmat p--------

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                    ********************************************
ipmaavkqalkeagdefelryrrafsdltsqlhitlATAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
------------------------------------                                            

       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
*************************************************************************
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                                                                         
© 1998-2022Legal notice