Dataset for protein BCL-2-like of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7G4L5_BCL2L2-02        ----------------------------------------MATPASAPDT
F7G4L5_BCL2L2-03        --------------------------------------------MAAAAA
F7HUE9_MCL1-01          ------------------------------------------MFGLKRNA
A0A5F7ZZ15_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEW--------DAGDVGAATPGA
A0A5F7ZJK5_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
A0A5F7ZJK5_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
A0A5F7ZJK5_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
A0A5F7ZJK5_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
A0A5F7ZJK5_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
F7E8V5_BCL2A1-01        -MTDCEFGYIYR-LAQDYLQYVLQI------PQPGSGPSKTSRV------
F7G4L5_BCL2L2-01        -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG--EGPAADP------
F7H6U5_BCL2L10-01       -MADPLRERTER-LLADYLG--------CCAREPGTPEPRPSTP------
                                                                          

F7G4L5_BCL2L2-02        RALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRA------------
F7G4L5_BCL2L2-03        AAAAAGAAGGR--------GSGPGRRRHLVPG------------------
F7HUE9_MCL1-01          VIGLNLYCGGA--------GLGAGSGGATPPGGRLLATEKE---------
A0A5F7ZZ15_BCL2-01      APAPGIFSSQPG-HTPHPAASRDPVARTSPLPTPAAPAAAAAAGPALSPV
A0A5F7ZJK5_BCL2L1-      METPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAA---------
A0A5F7ZJK5_BCL2L1-      METPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAA---------
A0A5F7ZJK5_BCL2L1-      METPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAA---------
A0A5F7ZJK5_BCL2L1-      METPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAA---------
A0A5F7ZJK5_BCL2L1-      METPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAA---------
F7E8V5_BCL2A1-01        --------------------------------------------------
F7G4L5_BCL2L2-01        --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
                                                                          

F7G4L5_BCL2L2-02        ----------AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQ
F7G4L5_BCL2L2-03        ----------AGGEAGEGAPGGAGDY------------------------
F7HUE9_MCL1-01          ---ASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPD
A0A5F7ZZ15_BCL2-01      PPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFR
A0A5F7ZJK5_BCL2L1-      ---VKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFR
A0A5F7ZJK5_BCL2L1-      ---VKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFR
A0A5F7ZJK5_BCL2L1-      ---VKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFR
A0A5F7ZJK5_BCL2L1-      ---VKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFR
A0A5F7ZJK5_BCL2L1-      ---VKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFR
F7E8V5_BCL2A1-01        ---LQKVAFSVQKEVEKNLKPCLDNVNVA---SIDTARTLFNQVMEKEFE
F7G4L5_BCL2L2-01        ---LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQ
F7H6U5_BCL2L10-01       ---EAAVLRSAA----ARLRQLHRSFFSAYRGYPGNRVELVALMAEAVLS
                                                                          

F7G4L5_BCL2L2-02        G--GPNWGRLVAFFVFGAALCA--------------ESVNKEMEPLVGQV
F7G4L5_BCL2L2-03        ------------------GNGL--------------ESEELEPEELLLEP
F7HUE9_MCL1-01          V--TASPARLLFFAPTRRASPL--------------EEMEAPAADAIMSP
A0A5F7ZZ15_BCL2-01      D--GVNWGRIVAFFEFGGVMCV--------------ESVNREMSPLVDNI
A0A5F7ZJK5_BCL2L1-      D--GVNWGRIVAFFSFGGALCV--------------ESVDKEMQVLVSRI
A0A5F7ZJK5_BCL2L1-      D--GVNWGRIVAFFSFGGALCV--------------ESVDKEMQVLVSRI
A0A5F7ZJK5_BCL2L1-      D--GVNWGRIVAFFSFGGALCV--------------ESVDKEMQVLVSRI
A0A5F7ZJK5_BCL2L1-      D--GVNWGRIVAFFSFGGALCV--------------ESVDKEMQVLVSRI
A0A5F7ZJK5_BCL2L1-      D--GVNWGRIVAFFSFGGALCV--------------ESVDKEMQVLVSRI
F7E8V5_BCL2A1-01        DG-IINWGRIVTIFAFEGILI---------------KKLLRQRIAPDVDT
F7G4L5_BCL2L2-01        G--GPNWGRLVAFFVFGAALCA--------------ESVNKEMEPLVGQV
F7H6U5_BCL2L10-01       DSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKRGFQPRLKEQEGDVARD
                                                            :             

F7G4L5_BCL2L2-02        QEWMVAYLETRLAD----WI---------------HSSGGW---------
F7G4L5_BCL2L2-03        EPEPEPEEEPPRPR----AP---------------PGAPGPGPGSGAPGS
F7HUE9_MCL1-01          EEELDGYEPEPLGK----RPAVLPLLELVGESGNSPSTDGSLPSTPPPAE
A0A5F7ZZ15_BCL2-01      ALWMTEYLNRHLHT----WI---------------QDNGGW---------
A0A5F7ZJK5_BCL2L1-      AAWMATYLNDHLEP----WI---------------QENGGW---------
A0A5F7ZJK5_BCL2L1-      AAWMATYLNDHLEP----WI---------------QENGGW---------
A0A5F7ZJK5_BCL2L1-      AAWMATYLNDHLEP----WI---------------QENGGW---------
A0A5F7ZJK5_BCL2L1-      AAWMATYLNDHLEP----WI---------------QENGGW---------
A0A5F7ZJK5_BCL2L1-      AAWMATYLNDHLEP----WI---------------QENGGW---------
F7E8V5_BCL2A1-01        YKEISYFVAEFIMNNTGEWI---------------RQNGGW---------
F7G4L5_BCL2L2-01        QEWMVAYLETRLAD----WI---------------HSSGGW---------
F7H6U5_BCL2L10-01       CQRLVALLSSRLAGQHRAWL---------------QAQGGW---------
                                                               *          

F7G4L5_BCL2L2-02        ----------------------ELEAIKARVREMEEEAEKLKEL-QNEVE
F7G4L5_BCL2L2-03        QEEEEEPGLVEGDPGDGAIEDPELEAIKARVREMEEEAEKLKEL-QNEVE
F7HUE9_MCL1-01          EEEDE-------------LYRQSLEIISRYLREQATGAKDTKPMGRSGAT
A0A5F7ZZ15_BCL2-01      --------------------------------------------------
A0A5F7ZJK5_BCL2L1-      --------------------------------------------------
A0A5F7ZJK5_BCL2L1-      --------------------------------------------------
A0A5F7ZJK5_BCL2L1-      --------------------------------------------------
A0A5F7ZJK5_BCL2L1-      --------------------------------------------------
A0A5F7ZJK5_BCL2L1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
F7G4L5_BCL2L2-01        --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
                                                                          

F7G4L5_BCL2L2-02        KQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHG
F7G4L5_BCL2L2-03        KQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHG
F7HUE9_MCL1-01          SRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFS
A0A5F7ZZ15_BCL2-01      --------------------------------------------------
A0A5F7ZJK5_BCL2L1-      --------------------------------------------------
A0A5F7ZJK5_BCL2L1-      --------------------------------------------------
A0A5F7ZJK5_BCL2L1-      --------------------------------------------------
A0A5F7ZJK5_BCL2L1-      --------------------------------------------------
A0A5F7ZJK5_BCL2L1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
F7G4L5_BCL2L2-01        --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
                                                                          

F7G4L5_BCL2L2-02        CGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLA--LDESLFRGRQI
F7G4L5_BCL2L2-03        CGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLA--LDESLFRGRQI
F7HUE9_MCL1-01          DGVTNWGRIVTLISFGAFVA-KHLKTINQESCIEPLAESITDVLVRTKRD
A0A5F7ZZ15_BCL2-01      --------------------------------------------------
A0A5F7ZJK5_BCL2L1-      --------------------------------------------------
A0A5F7ZJK5_BCL2L1-      --------------------------------------------------
A0A5F7ZJK5_BCL2L1-      --------------------------------------------------
A0A5F7ZJK5_BCL2L1-      --------------------------------------------------
A0A5F7ZJK5_BCL2L1-      --------------------------------------------------
F7E8V5_BCL2A1-01        --------------------------------------------------
F7G4L5_BCL2L2-01        --------------------------------------------------
F7H6U5_BCL2L10-01       --------------------------------------------------
                                                                          

F7G4L5_BCL2L2-02        KVIPKRTNRPGISTTDR-GFPRARYRARTTNYNSSRSRFY---SGFNSRP
F7G4L5_BCL2L2-03        KVIPKRTNRPGISTTDR-GFPRARYRARTTNYNSSRSRFY---SGFNSRP
F7HUE9_MCL1-01          WLVKQRGW--------D-GFVEFFHVEDLEGGIRNVLLAF---AGVAGVG
A0A5F7ZZ15_BCL2-01      ----------------D-AFVELYGPSMRPLFDFSWLSLK---T-LLS--
A0A5F7ZJK5_BCL2L1-      ----------------S-LAVSPRLKFSGAISAHYKLRLP---CSRHS--
A0A5F7ZJK5_BCL2L1-      ----------------D-TFVELYGNNAAAESRKGQERFN---RWFLT--
A0A5F7ZJK5_BCL2L1-      ----------------D-TFVELYGNNAAAESRKGQERFN---RWFLT--
A0A5F7ZJK5_BCL2L1-      ----------------D-TFVELYGNNAAAESRKGQERFN---RWFLT--
A0A5F7ZJK5_BCL2L1-      ----------------D-TFVELYGNNAAAESRKGQERFN---RWFLT--
F7E8V5_BCL2A1-01        ----------------ENGFVKKFEP----------KSGW---MTFLE--
F7G4L5_BCL2L2-01        ----------------A-EFTALYGDGALEEARRLREGNWASVRTVLT--
F7H6U5_BCL2L10-01       ----------------D-GFCHFFRS-------PFPLAFW---RKLLI--
                                                                          

F7G4L5_BCL2L2-02        RGRVYRGRARATSWYSPY--
F7G4L5_BCL2L2-03        RGRVYRGRARATSWYSPY--
F7HUE9_MCL1-01          AGLAYLIR------------
A0A5F7ZZ15_BCL2-01      -LALVGACITLGAYLGHK--
A0A5F7ZJK5_BCL2L1-      -PASAS--------------
A0A5F7ZJK5_BCL2L1-      -GMTVAGVVLLGSLFSRK--
A0A5F7ZJK5_BCL2L1-      -GMTVAGVVLLGSLFSRK--
A0A5F7ZJK5_BCL2L1-      -GMTVAGVVLLGSLFSRK--
A0A5F7ZJK5_BCL2L1-      -GMTVAGVVLLGSLFSRK--
F7E8V5_BCL2A1-01        VTGKICEMLSLLKQYC----
F7G4L5_BCL2L2-01        GAVALGALVTVGAFFASK--
F7H6U5_BCL2L10-01       QAFLACLLATAFGYLWTRLL
                                            

© 1998-2020Legal notice