Dataset for protein BCL-2-like of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7E8V5_BCL2A1-01       MTDCEFGYIYR-LAQDYLQYVLQI------PQPGSGPSKTSRVLQKVAFS
F7H6U5_BCL2L10-01      MADPLRERTER-LLADYLG--------CCAREPGTPEPRPSTPEAAVLRS
F7G4L5_BCL2L2-01       MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG--EGPAADPLHQAMRA
F7G4L5_BCL2L2-02       MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG--EGPAADPLHQAMRA
                       *:        * *  *::              **     .:     .  :

F7E8V5_BCL2A1-01       VQKEVEKNLKPCLDNVNVA---SIDTARTLFNQVMEKEFED--GIINWGR
F7H6U5_BCL2L10-01      AA----ARLRQLHRSFFSAYRGYPGNRVELVALMAEAVLSDSPG-PTWGR
F7G4L5_BCL2L2-01       AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG--G-PNWGR
F7G4L5_BCL2L2-02       AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG--G-PNWGR
                       .      .:.    ..        ..    .  : :  :..  *  .***

F7E8V5_BCL2A1-01       IVTIFAFEGILIK--------------KLLRQRIAPDVDTYKE-ISYFVA
F7H6U5_BCL2L10-01      VVSLVTFAGTLLEREPLVTAWWKKRGFQPRLKEQEGDVARDCQRLVALLS
F7G4L5_BCL2L2-01       LVAFFVFGAALCA--------------ESVNKEMEPLVGQVQEWMVAYLE
F7G4L5_BCL2L2-02       LVAFFVFGAALCA--------------ESVNKEMEPLVGQVQEWMVAYLE
                       :*::..* . *                :   :     *    : :   : 

F7E8V5_BCL2A1-01       EFIMNNTGEWIRQNGGWENGFVKKF-------------------------
F7H6U5_BCL2L10-01      SRLAGQHRAWLQAQGGWD-GFCHFF-------------------------
F7G4L5_BCL2L2-01       TRLAD----WIHSSGGWA-EFTALYGDGALEEARRLRE------------
F7G4L5_BCL2L2-02       TRLAD----WIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMS
                         : .    *:. .***                                 

F7E8V5_BCL2A1-01       -------------------EPKSGWMTFLEVTGKICEMLSLLKQYC----
F7H6U5_BCL2L10-01      -----RSPFPLAFWRKLLIQAFLACLLATAFGYLWTRLL-----------
F7G4L5_BCL2L2-01       ---GNWASV------------RTVLTGAVALGALVT--------------
F7G4L5_BCL2L2-02       PPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNR
                                                                         

F7E8V5_BCL2A1-01       --------------------------------------------------
F7H6U5_BCL2L10-01      --------------------------------------------------
F7G4L5_BCL2L2-01       --------------------------------------------------
F7G4L5_BCL2L2-02       VTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTN
                                                                         

F7E8V5_BCL2A1-01       --------------------------------------------------
F7H6U5_BCL2L10-01      --------------------------------------------------
F7G4L5_BCL2L2-01       ------------------------------------------------VG
F7G4L5_BCL2L2-02       RPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARAT
                                                                         

F7E8V5_BCL2A1-01       ------
F7H6U5_BCL2L10-01      ------
F7G4L5_BCL2L2-01       AFFASK
F7G4L5_BCL2L2-02       SWYSPY
                             

© 1998-2020Legal notice