Dataset for protein BCL-2-like of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7G4L5_BCL2L2-02       MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG--EGPAADPLHQAMRA
F7E8V5_BCL2A1-01       MTDCEFGYIYR-LAQDYLQYVLQI------PQPGSGPSKTSRVLQKVAFS
F7G4L5_BCL2L2-01       MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG--EGPAADPLHQAMRA
F7H6U5_BCL2L10-01      MADPLRERTER-LLADYLG--------CCAREPGTPEPRPSTPEAAVLRS
                       *:        * *  *::              **     .:     .  :

F7G4L5_BCL2L2-02       AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG--GPNWGRL
F7E8V5_BCL2A1-01       VQKEVEKNLKPCLDNVNVA---SIDTARTLFNQVMEKEFEDG-IINWGRI
F7G4L5_BCL2L2-01       AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG--GPNWGRL
F7H6U5_BCL2L10-01      AA----ARLRQLHRSFFSAYRGYPGNRVELVALMAEAVLSDSPGPTWGRV
                       .      .:.    ..        ..    .  : :  :..    .***:

F7G4L5_BCL2L2-02       VAFFVFGAALCA--------------ESVNKEMEPLVGQVQEWMVAYLET
F7E8V5_BCL2A1-01       VTIFAFEGILI---------------KKLLRQRIAPDVDTYKEISYFVAE
F7G4L5_BCL2L2-01       VAFFVFGAALCA--------------ESVNKEMEPLVGQVQEWMVAYLET
F7H6U5_BCL2L10-01      VSLVTFAGTLLEREPLVTAWWKKRGFQPRLKEQEGDVARDCQRLVALLSS
                       *::..* . *                :   .:         : :   :  

F7G4L5_BCL2L2-02       RLAD----WIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSP
F7E8V5_BCL2A1-01       FIMNNTGEWIRQNGGWENGFVKKFEP----------K-------------
F7G4L5_BCL2L2-01       RLAD----WIHSSGGWA-EFTALYGDGALEEARRLRE-------------
F7H6U5_BCL2L10-01      RLAGQHRAWLQAQGGWD-GFCHFFRS-------PFPL-------------
                        : .    *:. .***                                  

F7G4L5_BCL2L2-02       PPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRV
F7E8V5_BCL2A1-01       ---------------------------SGW---MTFLEVTGKICEMLSLL
F7G4L5_BCL2L2-01       ---------------------------GNWASVRTVLTGAVALGALVTVG
F7H6U5_BCL2L10-01      ---------------------------AFW---RKLLIQAFLACLLATAF
                                                    :      *          .  

F7G4L5_BCL2L2-02       TILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNR
F7E8V5_BCL2A1-01       KQYC----------------------------------------------
F7G4L5_BCL2L2-01       AFFASK--------------------------------------------
F7H6U5_BCL2L10-01      GYLWTRLL------------------------------------------
                                                                         

F7G4L5_BCL2L2-02       PGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATS
F7E8V5_BCL2A1-01       --------------------------------------------------
F7G4L5_BCL2L2-01       --------------------------------------------------
F7H6U5_BCL2L10-01      --------------------------------------------------
                                                                         

F7G4L5_BCL2L2-02       WYSPY
F7E8V5_BCL2A1-01       -----
F7G4L5_BCL2L2-01       -----
F7H6U5_BCL2L10-01      -----
                            

© 1998-2020Legal notice