Dataset for protein BCL-2-like of organism Macaca mulatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                               .
------msqsnrelvvdflsyklsqkgy---------------------------------------spavngatghsss
mmatpasaydt--maalyvg-v-r----swsqfsdveenrteapegtesemetpsaingnpswhlvdvcgagpga-egpp
 atdgr-gp--aailgkrrqg-i-rrlle         dagdvgaa pgaapa gifssq g  tphc--sr---pstra
  haclt--ty gafqgkinapgqlnh                                        -g rqlpvarpkt
    aererie    m  gh   gi                                          pa pedes p g 
      f aaa                                                               p   a 
      a                                                                         
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                            .                                   
lda--------------------vkqalreagdefelryrrafsdltsqlhitpgtayqsfeqvvnelfrd--gvnwGri
spprevipmaaaagpalspvppvlhyvmgse-----t------revsaa-evyifsrrtrvttsaeavpqgsp-p-----
atvpaapaa              gqrtnfavskdvs-nlkqtlksmavry--sgepeqelpaprsdpslpap i-ts  l
trt                    egllaat qe l r f plhenfnlerrpg dn vgvirlmmpkgas g  ig   v
gg                      dkg  q a    p    d d al  p le  e g p ng  g e e          
                        aa   l      k    c a  f    g     e   g                  
                                    a                                           
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
vaffsfggalcv--------------esvdkemqvlv-------sriaawmatylndhlep----wiqenggwdt-----
----------tpreplvtawwkkrgfqprnrqrepplvegvpgvgqvqerlvaf-etr-adqtre-lhss--peleaika
 tlvv eavmla              kkqlvaqsggigaed ddvatyq-----v---r--nhgap----ea a-g  ms
 si t a t i-              galre epadd       tnspleitylassfimt      rqq   sad    
    e   i ae              d  e   i          dddek  sf  pr  hs      edm    n     
    a                                       a  cd  le  ae   n       a           
                                                            g                   
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------fvelygpnaaa---------------------------------esrkgwerlnrwflt
rvremeeeaeklkelqnevekqmnmspn-gn-pstdgslpstgpvimsieekmeadarsiyvgnvlygatq--frthlhg
pee ldgyepeplgkrpa lpltspfrss--s          p paeee delyrqsle isryrd-qsyals-ek-rts
                     alkkvlkpsrp                             earp-rlhskaevtavmiv
                      chfreegmle                                lrpkgng kdpcs gr
                       a   df g                                  ifeff    m p eq
                                                                 fed      k l   
                                                                   a        f   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
gmtvagvvll----------------------------------------------------------------------
cgsasrltt-cdkrvgdgvqrnhetafsghpkgfayiefsdkesvsrvmvhvfsdgvtnwgrtslaldeslfrgrqikvi
aaltna-aivtlr              q mlrkldikned vk l                 ivtlisfga vakhl t 
tvalg-m--e                                                                      
sfkiclklsa                                                                      
p    eci                                                                        
l                                                                               
                                                                                

       410       420       430       440       450       460       470         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
                                                                               
--------------------------------------------------------------gslfsrk----------
pkrtnrpgisttdrgflvrpraryrarttnynssrsrfhvedleggirnvllaysgfnsrpr-ryyr-raratswyspy
nqescieplaesitdv   tkrdwlvkqrgwdgfvef                fa vagvgalavl-g-ll        
                                                              f---wt           
                                                               lq ls           
                                                               kf gi           
                                                               ga ch           
                                                                  a            
© 1998-2022Legal notice