Dataset for protein BCL-2-like of organism Macaca mulatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:        * *  *::              **     .:     .  :.      .:.    ..        ..    
MatpasapdtR-LvaDyvgyklrq---vcgagPG--egpasdplhqvmrsagdefetrlrrtfsdlaaqlhvtpgsaqqr
 tdclrgyty a lq flq-----kgy---rq  tppsrtatveqkalfavq----knfkqllrsvnva---yidtrvtl
    eferie        v qi   c ape  sg pkp r  aa   ak v a   pchdnffs yrgs  n re 
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.  : :  :..  *  .***:*::..* . *                :   :     *    : :   :   : .    *
ftqvseelfqg--G-pnWGRlVaffvFggaLca--------------esvnkemeplVgqvqewmvayletrlad----W
vnlmmdkvlsdsp iit   v tlvt eat lkreplvtawwkkrgfqprrqrqagd dtykq-lsylvssfimnqtre 
  a ae          i si a a i ie              klll  i    ardc ri  f ae   gnhga 
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:. .***                                                                         
ihssGGWe-gfvklf--------------------------------pv-----------arsvyvgavaygalwtell-
lrqq   dneathkyvrgmleearrlrelqnevekqmnmspppgnws--pmsiwrkmliq-ktiwttntevtytve---s
 qan   al  iafrgdeae   ek k                  rgsfilafee leaepflglmlfldl gkicrmea
           c a                               aa            d   acl    f   a     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
llkqygsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrart
hfhgcc                                                                          
                                                                                

       330       340       350      
....:....|....:....|....:....|....:.
                                    
------------------------------------
tnynssrsrfysgfnsrprgrvyrgrarvtswyssy
                            agaffapk
                                    
© 1998-2020Legal notice