Dataset for protein BCL-2-like of organism Macaca mulatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:        * *  *::              **     .:     .  :.      .:.    ..        ..    
MatpasapdtR-LvaDyvgyklrq---vcgagPG--egpasdplhqvmrsagdefetrlrrtfsdlaaqlhvtpgsaqqr
 tdclrgyty a lq flq-----kgy---rq  tppsrtatveqkalfavq----knfkqllrsvnva---yidtrvtl
    eferie        v qi   c ape  sg pkp r  aa   ak v a   pchdnffs yrgs  n re 
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.  : :  :..    .***:*::..* . *                :   .:         : :   :   : .    *:
ftqvseelfqg--gpnWGRlVaffvFggaLca--------------esvnkemeplvgqvqewmvayletrlad----Wi
vnlmmdkvlsdspiit   v tlvt eat l-replvtawwkkrgfqprlrqrigpdvrtyqrlsylvssfimnqtre l
  a ae g       i si a a i ie              kkl   q ad addckei  f ae   gnhga  
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
. .***                                                               :      *   
hssGGWe-gfvklfvs--------l-e----------------------------------------vnw---rtvLeva
rqq   dneathkyrrgmleearr-rllqnevekqmnmspppgnagpvimsieekmeadarsiyvgnsgygsvmkl tqt
qan   al  iafrgpeae   epfpk                                        gf aataef igh
          c a ed       k k                                         ad      e  a 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       .                                                                        
fllcllvtvvtylc-k----------------------------------------------------------------
vkiggslsrlkqywt-lsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrartt
ghg emanlggifasrfl                                                              
 aa a   afaf  d                                                                 

       330       340       350     
....:....|....:....|....:....|....:
                                   
-----------------------------------
nynssrsrfysgfnsrprgrvyrgraratswyspy
                                   
                                   
© 1998-2020Legal notice