Dataset for protein BCL-2-like of organism Macaca mulatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------msqsnrelvvdflsyklsqkgysw-qfsd--enrteapegtesemetpsaingnp--h-----avngatghsss
mmadpr------------------------s----ve-----t------------------sw-lvdsp-----------
 attgltgydy ailakyvg v rir  vcgrqpgtppspps-vaaapnaaaavalfvsgrlrqtpyvcgsgpgvrratp
  hacesertt   aq  iq   q    e apg  sg pkmavgmskrgtvpllniys ykg  kghpa lrdpsaptlv
     arapie    m   h        c  ae     gagdrfgl ad rigaggac qa         a a r ghad
      f                               d a m     a      d a                e     
                                          d                                     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ldarevip-aa------------vkqalreagdefelryrrafsdltsqlhitpgtayqsfeqvvnelfrd--gvnwgRi
--------m--aagpalspvppv-------vqg-agtvlpgtagsyaaa------srv-r-t--se-v-qgsp-p----l
pgtqamraeke            lhavrfsga-d--rnfkqslrnv---yrvyif--rtlvatm-dk-p--g t-tpa -
 phpllpta              esltmeq  k vskgigplhdessv altsddr qg-p-pim-aelsv  iis   v
 lg  aa                aqkra i      e a  g aampp   lp an -e  pl ga   e    a     
                        a    a      a    d   fn    g      a  n  a    d          
                                         c    f                                 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          :                                                    *
vaffsfggalcv--------------esvdkemqvlvsriaawmatylndhlep----wi---------------qengG
----v--avsplreplvtawwkkrgfqprnrqrepplgqvqeelvaleetrradqtrerpavlpllelvgesgnspssp 
ltlv-tr-tnla              kkmllpqsgdivspeqrptyfvsepiptnhgaal               hqtd 
 siat erimi-               elea pieadmntyp ispe psf mr                     rgq  
 f  p a g ge                e   aad  ledcl  eg  ar  hn                      da  
    e                             a  dd  k  de   p  gk                      a   
    a                                a               g                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
w-------------------------------------------------------------------------------
slpstpppgsqeeeeepglvegdpgdgalyrqeleaikarvremeeeaeklkelgqnevekqmnmspppgnagpvimsie
pg gsga aee  d              iedps  i sryl  qatg kdt pm rsgatsrkaletlrrvgdg qrnh 
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ekmeadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaesldeslfrgrqi
tafqgml kldik e dvkslsrvmv vfsd vt wgr vtlisf afva khlktinq  ciep    itdv v tkrd
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                      
----------------d-gFvelygnnaaaesrkgqerfn---rwflt---gmtvagvvllgslfsrk--
kvipkrtnrpgisttdrntaprfryr-------ssrlslwasvsgvnsrprarvyrarata---y---ll
wlvkq gw        s l tsafrparttnynr--slny   ttlhivgvtalag-l---tay-wpy  
                e e ckp lvsslelgi-ywkggp   m-rag  qpvalcl-lrvlkwlgtr  
                a a  hk hsgmrpifdpnv aak   cs  e  gllsisimis fgq cs   
                     a  ekfdg gaahlp   f   ak     a gk lec     f ah   
                         de      ffk                f                 
© 1998-2023Legal notice