Dataset for protein Bcl-w of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7G4L5_BCL2L2-01      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
F7G4L5_BCL2L2-02      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                      **************************************************

F7G4L5_BCL2L2-01      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
F7G4L5_BCL2L2-02      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                      **************************************************

F7G4L5_BCL2L2-01      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-EFTA
F7G4L5_BCL2L2-02      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIK
                      ********************************************  *   

F7G4L5_BCL2L2-01      LYGDGALEEARRLRE---------------GNWASV------------RT
F7G4L5_BCL2L2-02      ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARS
                             *** .*.*               ** ..*            *:

F7G4L5_BCL2L2-01      VLTGAVALGALVT-------------------------------------
F7G4L5_BCL2L2-02      IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDK
                      : .* *  ** .                                      

F7G4L5_BCL2L2-01      --------------------------------------------------
F7G4L5_BCL2L2-02      ESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNY
                                                                        

F7G4L5_BCL2L2-01      -------------------------VGAFFASK
F7G4L5_BCL2L2-02      NSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
                                               . ::::. 

© 1998-2020Legal notice