Dataset for protein Bcl-w of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7G4L5_BCL2L2-01      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
F7G4L5_BCL2L2-02      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
F7G4L5_BCL2L2-03      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
                      **:.*:*. : . ...  .   *..  * ***  .***.....   .   

F7G4L5_BCL2L2-01      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GPNWGRLV
F7G4L5_BCL2L2-02      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GPNWGRLV
F7G4L5_BCL2L2-03      ESEELEP------EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSG---
                       .:*:*.      .:*  :    * . ::     :     * **. *   

F7G4L5_BCL2L2-01      AFFVFGAALCAESVNKEMEPLV-------GQVQEWMVAYLETRLADWIHS
F7G4L5_BCL2L2-02      AFFVFGAALCAESVNKEMEPLV-------GQVQEWMVAYLETRLADWIHS
F7G4L5_BCL2L2-03      ---------APGSQEEEEEPGLVEGDPGDGAIED----------------
                               .. * ::* ** :       * :::                

F7G4L5_BCL2L2-01      SGGWA-EFTALYGDGALEEARRLRE---------------GNWASV----
F7G4L5_BCL2L2-02      SGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
F7G4L5_BCL2L2-03      ---PELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
                            *          *** .*.*               ** ..*    

F7G4L5_BCL2L2-01      --------RTVLTGAVALGALVT---------------------------
F7G4L5_BCL2L2-02      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
F7G4L5_BCL2L2-03      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
                              *:: .* *  ** .                            

F7G4L5_BCL2L2-01      --------------------------------------------------
F7G4L5_BCL2L2-02      GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
F7G4L5_BCL2L2-03      GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
                                                                        

F7G4L5_BCL2L2-01      -----------------------------------VGAFFASK
F7G4L5_BCL2L2-02      ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
F7G4L5_BCL2L2-03      ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
                                                         . ::::. 

© 1998-2020Legal notice