Dataset for protein Bcl-w of organism Macaca mulatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:.*:*. : . ...  .   *..  * ***  .***.....   .    .:*:*.      .:*  :    * . :: 
MAtpAsApdtralvadfvgyklRqkgyVcGAG--pGEGpaadplhqamraagdEfEtrfrrtfsdLaaqlhvtPgsaqqr
  aa a aaaagaaggrgsgpg rrhl p   gea   apggagdygnglese l p------ee llepepe epeeep

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    :     * **. *            .. * ::* ** :       * :::                      *   
ftqvsdelfqG-GPnwGrlvaffvfgaalcaeSvnkEmEPlv-------GqvqewmvayletrladwihssggwelEaik
prprappgap p  gs ------------apg qee e  glvegdpgd aied-------------------pa- fta

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       *** .*.*               ** ..*            *:: .* *  ** .                  
arvremeEEAekLkElqnevekqmnmspppGNagpVimsieekmeadaRsiyvGnVdyGAtaeeleahfhgcgsvnrvti
lygdgal   rr r ---------------  was ------------ tvlt a al  lvt-----------------

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
lcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysg
--------------------------------------------------------------------------------

       330       340   
....:....|....:....|...
               . ::::. 
fnsrprgrvyrgraratswyspy
---------------vgaffask
© 1998-2022Legal notice