Dataset for protein Mcl-1 of organism Lynx canadensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A667GXX5_MCL1-02      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLV--------------
A0A667GXX5_MCL1-01      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGG
                        ************************************              

A0A667GXX5_MCL1-02      --------------------------------------------------
A0A667GXX5_MCL1-01      GEAGAVIGGSAGASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFA
                                                                          

A0A667GXX5_MCL1-02      --------------------------------------------------
A0A667GXX5_MCL1-01      ATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
                                                                          

A0A667GXX5_MCL1-02      ---------------------------------------ATGAKDAKPLG
A0A667GXX5_MCL1-01      SSGPGTDGSLPSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLG
                                                               ***********

A0A667GXX5_MCL1-02      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A667GXX5_MCL1-01      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
                        **************************************************

A0A667GXX5_MCL1-02      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A667GXX5_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
                        **************************************************

A0A667GXX5_MCL1-02      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A667GXX5_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                        **************************************************

© 1998-2020Legal notice