Dataset for protein Mcl-1 of organism Lynx canadensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************                                            
MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLV--------------------------------------------
                                    avgkeatarrevgggeagaviggsagasppatlapdarrvarps

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pigaegpdvtatppkllffaatrcasppekmegpaadaimspeeeldgyepeplgkrpavlpllelvgeassgpgtdgsl

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             ***************************************************
-----------------------------ATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
pstpppaeeeedelfrqsleiisrylreq                                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
                                                                                

       330       340       350
....:....|....:....|....:....|
******************************
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                              
© 1998-2020Legal notice