Dataset for protein Mcl-1 of organism Leptobrachium leishanense

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5PJK5_MCL1-01      MCTCTLMERGSRWAGPDQ---RGWLKRRAAMRAKPGTLLHSLREGYGWIP
A0A8C5QRL7_MCL1-01      ------------MNGAGHFVVAGLFCDGRGTCCLSGALLR-----FSWI-
                                      *..:    * :    .  . .*:**.     :.** 

A0A8C5PJK5_MCL1-01      GPVLPPDHFNKVYKRQPNAVLRLSHQCRERAAFTAAERDAARCLSLCGHS
A0A8C5QRL7_MCL1-01      --------------------------------------------------
                                                                          

A0A8C5PJK5_MCL1-01      LARPATPPRLKLVGLQFPALSAQIIIKMEAGKVAVAMALREKEVQEDAAG
A0A8C5QRL7_MCL1-01      ----------------FPMFCS----------------------------
                                        ** :.:                            

A0A8C5PJK5_MCL1-01      YGDTCRAPESIMQASNAEKKEREDHGDTYQAQENSMQSSEAEREGEEGPE
A0A8C5QRL7_MCL1-01      --------------------------------------------------
                                                                          

A0A8C5PJK5_MCL1-01      TTRDTCQTQENPMQPSEAEREEGPESTCQAQKCFLETSEALEERQGEESP
A0A8C5QRL7_MCL1-01      --------------------------------------------------
                                                                          

A0A8C5PJK5_MCL1-01      EDSTDTCQSLQNFLESSEAEQEEEDRDDKKMEADVPGPSPPPEDPQCRQD
A0A8C5QRL7_MCL1-01      ----------------------------------ICPPSRFPGGLSCRRV
                                                          :  **  * . .**. 

A0A8C5PJK5_MCL1-01      ELFLYSRLLLLTFFREYAGGPDPGPVRALIQLAMPNTALQTLLRVARETI
A0A8C5QRL7_MCL1-01      SLRLAHYMKLLYKGRRCLCRPAP---------------------------
                        .* *   : **   *     * *                           

A0A8C5PJK5_MCL1-01      ERNHACFQNTLNRLCIERPEHLQKLSLVTFALFSDGAINWGRIATLFSFT
A0A8C5QRL7_MCL1-01      ------LHGMLTKLSIQQAEDLQKLSEVPSLVFNDGITNWGRIVTLISFG
                              ::. *..*.*:..* ***** *.  :*.**  *****.**:** 

A0A8C5PJK5_MCL1-01      ALVARHLKNLGMNDSIFTLADGVARFLTITKRSWFQEHQGWDGFVEFFLV
A0A8C5QRL7_MCL1-01      AFLAKHLQSIKLEDCIVPLADNFTDYLMTSKREWIMQQKSWDGFVEFFHV
                        *::*.**:.: ::*.*..***..: :*  :**.*: :::.******** *

A0A8C5PJK5_MCL1-01      SRWQTGIRIALLALAIFAGIATSLLYLIM
A0A8C5QRL7_MCL1-01      EDYESGLRTVLMTFAGVAGIGASLAYMIR
                        . :::*:* .*:::* .***.:** *:* 

© 1998-2022Legal notice