Dataset for protein Mcl-1 of organism Leptobrachium leishanense

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              *..:    * :    .  . .*:**.     :.**                               
------------wnGpgq---rGwlkrrrgtrclsGtLLr-----ysWI-------------------------------
mctctlmergsrma adhfvva lfcdgaamcakp a  hslregfg  pgpvlppdhfnkvykrqpnavlrlshqcrer

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                    ** :.:                                      
------------------------------------FPmlss--------------------------------------
aaftaaerdaarclslcghslarpatpprlklvglq  afcaqiiikmeagkvavamalrekevqedaagygdtcrapes

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
imqasnaekkeredhgdtyqaqensmqsseaeregeegpettrdtcqtqenpmqpseaereegpestcqaqkcfletsea

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                            :  **  * . .**. .* *   : **   *     
--------------------------------------------vppPSrpPggpsCRrvsLrLysymlLLykgRrylgr
leerqgeespedstdtcqslqnflesseaeqeeedrddkkmeadicg  pf edlq  qde f ahrlk  tff ecacg

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* *                                 ::. *..*.*:..* ***** *.  :*.**  *****.**:** 
PdP---------------------------------lqntLtrLsIqrpEhLQKLSlVtslvFsDGitNWGRIvTLiSFt
 a gpvraliqlampntalqtllrvaretiernhacfhgm nk c eqa d     e pfal n  ai     a  f  g

       410       420       430       440       450       460       470         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
*::*.**:.: ::*.*..***..: :*  :**.*: :::.******** *. :::*:* .*:::* .***.:** *:* 
AlvArHLqslkmnDsIvtLADnvtryLtttKRsWiqqqqsWDGFVEFFlVsryqtGlRtvLmtlAivAGIgtSLlYmIr
 fl k  knigle c fp   gfadf mis  e fmehkg        h edwes i ia laf gf   aa  a l m
© 1998-2022Legal notice