Dataset for protein Bcl-2 of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P10415_BCL2-09      ------------------------------------------------------------
P10415_BCL2-03      ------------------------------------------------------------
P10415_BCL2-08      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
P10415_BCL2-06      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
P10415_BCL2-07      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
A9QXG9_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
P10415_BCL2-05      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
P10415_BCL2-04      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
P10415_BCL2-10      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
                                                                                

P10415_BCL2-09      ------------------MEDA--------------------------------------
P10415_BCL2-03      ------------MNPRVPGQDA--------------------------------------
P10415_BCL2-08      ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
P10415_BCL2-06      ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
P10415_BCL2-07      ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
A9QXG9_BCL2-01      ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
P10415_BCL2-05      ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
P10415_BCL2-04      ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
P10415_BCL2-10      ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
                                         *                                      

P10415_BCL2-09      ------------------------------------------------------------
P10415_BCL2-03      ------------------------------------------------------------
P10415_BCL2-08      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
P10415_BCL2-06      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
P10415_BCL2-07      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
A9QXG9_BCL2-01      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
P10415_BCL2-05      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
P10415_BCL2-04      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
P10415_BCL2-10      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
                                                                                

P10415_BCL2-09      -----------------FVELY---------------------------GPSMRPLFDFS
P10415_BCL2-03      -----------------FVELY---------------------------GPSMRPLFDFS
P10415_BCL2-08      LNRHLHTWIQDNGGWTETQDLFNSNACSPTPAALATTILLPASMNLTTLGTSHKWTHTCD
P10415_BCL2-06      LNRHLHTWIQDNGGWDAFVELY---------------------------GPSMRPLFDFS
P10415_BCL2-07      LNRHLHTWIQDNGGWDAFVELY---------------------------GPSMRPLFDFS
A9QXG9_BCL2-01      LNRHLHTWIQDNGGWDAFVELY---------------------------GPSMRPLFDFS
P10415_BCL2-05      LNRHLHTWIQDNGGWLYM------------------------------------------
P10415_BCL2-04      LNRHLHTWIQDNGGWVGALGDV---------------------------SLG--------
P10415_BCL2-10      LNRHLHTWIQDNGGWVGALGDV---------------------------SLG--------
                                                                                

P10415_BCL2-09      WLSLKTLLSLALVG--ACITLGAYLGHK
P10415_BCL2-03      WLSLKTLLSLALVG--ACITLGAYLGHK
P10415_BCL2-08      WLVTLSMMSSRFIHVLACVTASFILKAE
P10415_BCL2-06      WLSLKTLLSLALVG--ACITLGAYLGHK
P10415_BCL2-07      WLSLKTLLSLALVG--ACITLGAYLGHK
A9QXG9_BCL2-01      WLSLKTLLSLALVG--ACITLGAYLSHK
P10415_BCL2-05      ----------------------------
P10415_BCL2-04      ----------------------------
P10415_BCL2-10      ----------------------------
                                                

© 1998-2021Legal notice