Dataset for protein Bcl-2 of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mahagrtgydnreivmkyihyklsqrgyewdagdvgaappgaapapgifssqpghtphpaasrdpvartsplqtpaapga
------------------------------------------------------------------------------mq
                                                                        mn rv  e
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *                                                                              
aAgpalspvppvvhltlrqagddfsrryrrdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmcve
d ------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
svnremsplvdnialwmteylnrhlhtwiqdnggwdafvely---------------------------gpsmrplfdfs
-------------------------------------algdvnsnacsptpaalattillpasmnlttlslg--------
                                   vgt----                           ---hkwthtcd
                                   tymqd f                            t         
                                   le                                           

       250       260        
....:....|....:....|....:...
                            
wlslktllslalvg--acitlgaylghk
--------------vl------------
  vtlsmm srfih    v asfi sae
                         k  
                            
© 1998-2022Legal notice