Dataset for protein BCL-2-like of organism Heterocephalus glaber

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G5ASL3_BCL2L2-01      -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG---------------
G5ASL3_BCL2L2-02      -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG---------------
G5BQH7_BCL2L1-01      ------MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEESRTEAPE----G
G5BGZ7_BCL2-02        MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDGSAAPPGAAPTPGIFS
G5BGZ7_BCL2-01        MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDGSAAPPGAAPTPGIFS
                             . ... :* .:: *** *.**  .   .               

G5ASL3_BCL2L2-01      ---------------------------------------EGPAADPLHQA
G5ASL3_BCL2L2-02      ---------------------------------------EGPAADPLHQA
G5BQH7_BCL2L1-01      TESEMETPSAISGNPSWHLADSPTVNGATGHSSSLDAREVIPMAAVKQ-A
G5BGZ7_BCL2-02        SQPGRNSPPAAPRDLAARTSPPPPLAGLAAAAGPV----LSPVPPVVHLT
G5BGZ7_BCL2-01        SQPGRNSPPAAPRDLAARTSPPPPLAGLAAAAGPV----LSPVPPVVHLT
                                                               * .   : :

G5ASL3_BCL2L2-01      MRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGR
G5ASL3_BCL2L2-02      MRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGR
G5BQH7_BCL2L1-01      LREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGR
G5BGZ7_BCL2-02        LRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGR
G5BGZ7_BCL2-01        LRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGR
                      :* ***:*. *:** *:::::***:** :*   *  * :***..* ****

G5ASL3_BCL2L2-01      LVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA
G5ASL3_BCL2L2-02      LVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW-
G5BQH7_BCL2L1-01      IVAFFSFGGALCVESVDKEMQVLVRRIASWMATYLNDHLEPWIQENGGWD
G5BGZ7_BCL2-02        IVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGW-
G5BGZ7_BCL2-01        IVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWD
                      :**** **..:*.***:.**. ** .:  **. **: .*  **:..*** 

G5ASL3_BCL2L2-01      EFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK-
G5ASL3_BCL2L2-02      ----------------------------LISRGKMGALIGGWGSCAGKE
G5BQH7_BCL2L1-01      TFVELYGNNAAAESRK----GQERFNRWFLTGMTVAGMVLLGSLFSRK-
G5BGZ7_BCL2-02        --VGLRQPT----------------DT-MASLMCVGLWVKLGA------
G5BGZ7_BCL2-01        AFVELYGPSVRPLFDF----SWLSLKT-LLSLALVGACITLGAYLGHK-
                                                  :     :.  :   .      

© 1998-2020Legal notice