Dataset for protein BCL-2-like of organism Heterocephalus glaber

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|G5ASL3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Heterocephalus glaber GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|G5ASL3_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Heterocephalus glaber GN=BCL2L2 (length=165 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWLISRGKMGALIGGWGS
CAGKE
>gnl|bcl2dbpro|G5BGZ7_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Heterocephalus glaber GN=BCL-2 (length=219 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDGSAAPPGAAPTPGIFSSQPGRNSPPAAPRDLAARTSPPPPLAGLAA
AAGPVLSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWVGLRQPTDTMASLMCVGLWVKLGA
>gnl|bcl2dbpro|G5BGZ7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Heterocephalus glaber GN=BCL-2 (length=239 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDGSAAPPGAAPTPGIFSSQPGRNSPPAAPRDLAARTSPPPPLAGLAA
AAGPVLSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|G5BQH7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Heterocephalus glaber GN=BCL2L1 (length=233 residues).
MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEESRTEAPEGTESEMETPSAISGNPSWHLADSPTVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVRRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGMVLLGSLFSRK
© 1998-2020Legal notice