Dataset for protein Bfl1 of organism Gorilla gorilla gorilla

[Download (right click)] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A2I2YJV4_BCL2A1-01      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEK
A0A2I2YJV4_BCL2A1-02      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEK
A0A2I2YJV4_BCL2A1-03      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEK
                          **************************************************

A0A2I2YJV4_BCL2A1-01      NLKSCLDNVNVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
A0A2I2YJV4_BCL2A1-02      NLKSCLDNVNVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
A0A2I2YJV4_BCL2A1-03      NLKSCLDNVNVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
                          **************************************************

A0A2I2YJV4_BCL2A1-01      KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP
A0A2I2YJV4_BCL2A1-02      KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP
A0A2I2YJV4_BCL2A1-03      KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWH------
                          **************************************** : .      

A0A2I2YJV4_BCL2A1-01      KSGWMTFLEVTGKIC---------------------EMLSL--LKQYC
A0A2I2YJV4_BCL2A1-02      KSGWMTFLEVTGKISILLTRKDTPYCETGLIFLTVMETIAN--TYFYF
A0A2I2YJV4_BCL2A1-03      --------NHTPML---------------------VESVAHKKRKMAL
                                  : *  :                      * ::        

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice