Dataset for protein Bfl1 of organism Gorilla gorilla gorilla

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKEFE
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************************************ :              : : 
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWgn--------------wlnv
                                                            ekgfvkkfepksgwmtfheh

       170       
....:....|....:..
*  : * ::  *.    
TpmlvEsvsllKrym--
 gkic mlahk qkcal
© 1998-2020Legal notice