Dataset for protein BCL-2-like of organism Gallus gallus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1L1RNM6_MCL1-02      --------------------------------------------------
A0A1L1RNM6_MCL1-01      ------------------------------MGVGPASGSGAKRPLWPFFT
A0A1L1RNM6_MCL1-03      MHGVQQGTHHRFLERLRGRTPPQLPALSRRMGVGPASGSGAKRPLWPFFT
Q9W6F2_BCL2A1-01        --------------------------------------------------
Q00709_BCL2-01          --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
                                                                          

A0A1L1RNM6_MCL1-02      --------------------------------------------------
A0A1L1RNM6_MCL1-01      PKFHFSPPRTPRARHDRSPLPSPRGGRTGSGTAPPWRHRGHITVPALPAR
A0A1L1RNM6_MCL1-03      PKFHFSPPRTPRARHDRSPLPSPRGGRTGSGTAPPWRHRGHITVPALPAR
Q9W6F2_BCL2A1-01        --------------------------------------------------
Q00709_BCL2-01          --------------------------------------------------
Q07816_BCL2L1-01        --------------------------------------------------
                                                                          

A0A1L1RNM6_MCL1-02      ----------MFAVKRNAVIGFNLYCGGGSPGLVPASPAGEQTPPPAAAA
A0A1L1RNM6_MCL1-01      ATRRRCSLGAMFAVKRNAVIGFNLYCGGGSPGLVPASPAGEQTPPPAAAA
A0A1L1RNM6_MCL1-03      ATRRRCSLGAMFAVKRNAVIGFNLYCGGGSPGLVPASPAGEQTPPPAAAA
Q9W6F2_BCL2A1-01        ------METAEFYYVYYLAQDYLQY-------------------------
Q00709_BCL2-01          ----MAHPGRRGYDNREIVLKYIHY-------------------------
Q07816_BCL2L1-01        ----------MSSSNRELVIDFVSY-------------------------
                                          .  :  *                         

A0A1L1RNM6_MCL1-02      PAAAAATVAEVPRPLIGSAGLWAAAGRAEAPRAPIGSGAAPHAPIGSAAA
A0A1L1RNM6_MCL1-01      PAAAAATVAEVPRPLIGSAGLWAAAGRAEAPRAPIGSGAAPHAPIGSAAA
A0A1L1RNM6_MCL1-03      PAAAAATVAEVPRPLIGSAGLWAAAGRAEAPRAPIGSGAAPHAPIGSAAA
Q9W6F2_BCL2A1-01        -------------VLQESHLG-----------------------------
Q00709_BCL2-01          -------------KLSQRGYDWAAGEDRPPVPPAPAPAAAPAAVAAAGAS
Q07816_BCL2L1-01        -------------KLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGSPS
                                      *                                   

A0A1L1RNM6_MCL1-02      RRAPPDSTSRPVALWSPEEELDGCEPESERGPGGDSLPGTPPELPDLIPD
A0A1L1RNM6_MCL1-01      RRAPPDSTSRPVALWSPEEELDGCEPESERGPGGDSLPGTPPELPDLIPD
A0A1L1RNM6_MCL1-03      RRAPPDSTSRPVALWSPEEELDGCEPESERGPGGDSLPGTPPELPDLIPD
Q9W6F2_BCL2A1-01        --------------------------------------------------
Q00709_BCL2-01          SHHRPE-------------------------PPGSAAASEVPPAEGLR--
Q07816_BCL2L1-01        WH---P-------------------------PAGHVVNGATVHRSSLEVH
                                                                          

A0A1L1RNM6_MCL1-02      ELRQESLELILRYLREAAGEAEPGVKKLFPGLLGGPGRPGRASSAVMEKA
A0A1L1RNM6_MCL1-01      ELRQESLELILRYLREAAGEAEPGVKKLFPGLLGGPGRPGRASSAVMEKA
A0A1L1RNM6_MCL1-03      ELRQESLELILRYLREAAGEAEPGVKKLFPGLLGGPGRPGRASSAVMEKA
Q9W6F2_BCL2A1-01        --PAQT------------------------------------------RV
Q00709_BCL2-01          --PAPP------------------------------------------GV
Q07816_BCL2L1-01        EIVRAS------------------------------------------DV
                             .                                           .

A0A1L1RNM6_MCL1-02      LETLRRVGDGVMQKHELAFQGMLRKLEIKKEDDLQA-VCEVAAHVFNDGV
A0A1L1RNM6_MCL1-01      LETLRRVGDGVMQKHELAFQGMLRKLEIKKEDDLQA-VCEVAAHVFNDGV
A0A1L1RNM6_MCL1-03      LETLRRVGDGVMQKHELAFQGMLRKLEIKKEDDLQA-VCEVAAHVFNDGV
Q9W6F2_BCL2A1-01        AHVLRNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFADGN
Q00709_BCL2-01          HLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTAHGR-FVAVVEELFRDG-
Q07816_BCL2L1-01        RQALRDAGDEFELRYRRAFSDLTSQLHITPGTAYQS-FEQVVNELFHDG-
                          .**  .. .  .    :  :  .: :.        .  *    * ** 

A0A1L1RNM6_MCL1-02      TNWGRVVTLISFGAFVAKHLKSINQEKC---ITSLAGIITDALVSSKREW
A0A1L1RNM6_MCL1-01      TNWGRVVTLISFGAFVAKHLKSINQEKC---ITSLAGIITDALVSSKREW
A0A1L1RNM6_MCL1-03      TNWGRVVTLISFGAFVAKHLKSINQEKC---ITSLAGIITDALVSSKREW
Q9W6F2_BCL2A1-01        TNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEKISYFITEYIINNKAAW
Q00709_BCL2-01          VNWGRIVAFFEFGGVMCVESVNREMSPL---VDNIATWMTEYLNRHLHNW
Q07816_BCL2L1-01        VNWGRIVAFFSFGGALCVESVDKEMRVL---VGRIVSWMTTYLTDHLDPW
                        .****::::: **. :     .            :   :*  :      *

A0A1L1RNM6_MCL1-02      LMSQGGWEGFVDFFRVEDLESSIRNVLMAFAGVAGLGASLAYMIRPGPHP
A0A1L1RNM6_MCL1-01      LMSQGGWEGFVDFFRVEDLESSIRNVLMAFAGVAGLGASLAYMIR-----
A0A1L1RNM6_MCL1-03      LMSQGGWEGFVDFFRVEDLESSIRNVLMAFAGVAGLGASLAYMIR-----
Q9W6F2_BCL2A1-01        IDANGGWVSF-NLVS-SHFPAQRRFKHLS---------------------
Q00709_BCL2-01          IQDNGGWDAFVELYG-NSMRPLFDFSWISLKT-ILSLVLVGACITLGAYL
Q07816_BCL2L1-01        IQENGGWERFVDLYG-NNAAAELRKGQETFNKWLLTGATVAGVLLLGSLL
                        :  :***  * ::   .   .       :                     

A0A1L1RNM6_MCL1-02      RPPGMGHPQNEAAVTAARGLQVRNFFLTGDLNKWLF
A0A1L1RNM6_MCL1-01      --------------------------------KWRS
A0A1L1RNM6_MCL1-03      ------------------------------------
Q9W6F2_BCL2A1-01        ------------------------------------
Q00709_BCL2-01          GHK---------------------------------
Q07816_BCL2L1-01        SRK---------------------------------
                                                            

© 1998-2022Legal notice