Dataset for protein BCL-2-like of organism Gallus gallus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A1L1RNM6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gallus gallus GN=MCL-1 (length=415 residues).
MGVGPASGSGAKRPLWPFFTPKFHFSPPRTPRARHDRSPLPSPRGGRTGSGTAPPWRHRGHITVPALPARATRRRCSLGA
MFAVKRNAVIGFNLYCGGGSPGLVPASPAGEQTPPPAAAAPAAAAATVAEVPRPLIGSAGLWAAAGRAEAPRAPIGSGAA
PHAPIGSAAARRAPPDSTSRPVALWSPEEELDGCEPESERGPGGDSLPGTPPELPDLIPDELRQESLELILRYLREAAGE
AEPGVKKLFPGLLGGPGRPGRASSAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIKKEDDLQAVCEVAAHVFNDGVT
NWGRVVTLISFGAFVAKHLKSINQEKCITSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLESSIRNVLMAFAGVA
GLGASLAYMIRKWRS
>gnl|bcl2dbpro|A0A1L1RNM6_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gallus gallus GN=MCL-1 (length=372 residues).
MFAVKRNAVIGFNLYCGGGSPGLVPASPAGEQTPPPAAAAPAAAAATVAEVPRPLIGSAGLWAAAGRAEAPRAPIGSGAA
PHAPIGSAAARRAPPDSTSRPVALWSPEEELDGCEPESERGPGGDSLPGTPPELPDLIPDELRQESLELILRYLREAAGE
AEPGVKKLFPGLLGGPGRPGRASSAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIKKEDDLQAVCEVAAHVFNDGVT
NWGRVVTLISFGAFVAKHLKSINQEKCITSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLESSIRNVLMAFAGVA
GLGASLAYMIRPGPHPRPPGMGHPQNEAAVTAARGLQVRNFFLTGDLNKWLF
>gnl|bcl2dbpro|A0A1L1RNM6_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gallus gallus GN=MCL-1 (length=441 residues).
MHGVQQGTHHRFLERLRGRTPPQLPALSRRMGVGPASGSGAKRPLWPFFTPKFHFSPPRTPRARHDRSPLPSPRGGRTGS
GTAPPWRHRGHITVPALPARATRRRCSLGAMFAVKRNAVIGFNLYCGGGSPGLVPASPAGEQTPPPAAAAPAAAAATVAE
VPRPLIGSAGLWAAAGRAEAPRAPIGSGAAPHAPIGSAAARRAPPDSTSRPVALWSPEEELDGCEPESERGPGGDSLPGT
PPELPDLIPDELRQESLELILRYLREAAGEAEPGVKKLFPGLLGGPGRPGRASSAVMEKALETLRRVGDGVMQKHELAFQ
GMLRKLEIKKEDDLQAVCEVAAHVFNDGVTNWGRVVTLISFGAFVAKHLKSINQEKCITSLAGIITDALVSSKREWLMSQ
GGWEGFVDFFRVEDLESSIRNVLMAFAGVAGLGASLAYMIR
>gnl|bcl2dbpro|Q00709_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Gallus gallus GN=BCL-2 (length=233 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRPPVPPAPAPAAAPAAVAAAGASSHHRPEPPGSAAASEVPPAEGL
RPAPPGVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTAHGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SPLVDNIATWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|Q07816_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Gallus gallus GN=BCL2L1 (length=229 residues).
MSSSNRELVIDFVSYKLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWHPPAGHVVNGATVHRSSLEVHEIVRAS
DVRQALRDAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMRVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|Q9W6F2_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Gallus gallus GN=BCL2A1 (length=160 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEKISYFITEYIINNKAAWIDANGGWVSFNLVSSHFPAQRRFKHLS
© 1998-2022Legal notice