Dataset for protein Mcl-1 of organism Gadus morhua

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


D2ITA0_MCL1-01      MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALP--------LMAT
D2ITA0_MCL1-04      -------------------MSDPRDIDEDAILKGLSSAELEQLECELQDLDPENAMLPAG
D2ITA0_MCL1-02      MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALP--------LMAT
D2ITA0_MCL1-03      MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALP--------LMAT
                                       :..*.: .*:  :.  *...    *  *         * * 

D2ITA0_MCL1-01      FKSGDERKPRPTE----------LGRGRLVNKSQDD---------------QEGNGSLPS
D2ITA0_MCL1-04      YRQRDQTKKTPTGDYDRDALQDYLEKSALEHEDREDLIPFTGEKKGRKAFVPTATGQIPL
D2ITA0_MCL1-02      FKSGDERKPRPTE----------LGRGRLVNKSQDD---------------QEGNGSLPS
D2ITA0_MCL1-03      FKSGDERKPRPTE----------LGRGRLVNKSQDD---------------QEGNGSLPS
                    :.. *: *  **           * .. * ::..:*                 ..*.:* 

D2ITA0_MCL1-01      TPE--LQSEVDTDSQAGEEVLDNDTKRIIRIFL----RDYAGA--SKAKRTRQDEVQVTM
D2ITA0_MCL1-04      SEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQYYDALGCTGKIANTEGINSVV
D2ITA0_MCL1-02      TPE--LQSEVDTDSQAGEEVLDNDTKRIIRIFL----RDYAGA--SKAKRTRQDEVQVTM
D2ITA0_MCL1-03      TPE--LQSEVDTDSQAGEEVLDNDTKRIIRIFL----RDYAGA--SKAKRTRQDEVQVTM
                    : :  *:.*::   : . :.   *   *: ::     .:* .*  ...* :. : :: .:

D2ITA0_MCL1-01      RR--------------VVDGVLEKHQYAYKGMIQKLELDGRGEDMSFVTSVAKSLFADST
D2ITA0_MCL1-04      KQDPFKIFPEEPPNTTNVEETVERIHNNDSGLTEVNLNNIKDIPIPTLKEVFEAMKGNSY
D2ITA0_MCL1-02      RR--------------VVDGVLEKHQYAYKGMIQKLELDGRGEDMSFVTSVAKSLFADST
D2ITA0_MCL1-03      RR--------------VVDGVLEKHQYAYKGMIQKLELDGRGEDMSFVTSVAKSLFADST
                    ..               *: .:*. :   .*: :    : ..  :. :..* ::: .:* 

D2ITA0_MCL1-01      TNWGRIASL-----VAFGAA--------------LCQYLEARGKEGCVSLVAEEISSYLL
D2ITA0_MCL1-04      VEILSIAATRSNDPVAFACAEMLQENTSLQSLNIESNFITAEGMKAVVKAMASNATLVEL
D2ITA0_MCL1-02      TNWGRIASL-----VAFGAA--------------LCQYLEARGKEGCVSLVAEEISSYLL
D2ITA0_MCL1-03      TNWGRIASL-----VAFGAA--------------LCQYLEARGKEGCVSLVAEEISSYLL
                    .:   **:      ***..*               .::: * * :. *. :*.: :   *

D2ITA0_MCL1-01      SDQREWLVKNNSWNAMLPAGYRQRDQTKKTPTGDYDRDALQDYLEKSALEHEDREDLIPF
D2ITA0_MCL1-04      KIDNQRHTLGDSVE----------------------------------------------
D2ITA0_MCL1-02      SDQREWLVKNNSWEGF--------------------------------------------
D2ITA0_MCL1-03      SDQREWLVKNNSWEGF--------------------------------------------
                    . :.:. . .:* :                                              

D2ITA0_MCL1-01      TGEKKGKAFVPTATGQIPLSEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQYY
D2ITA0_MCL1-04      ------------------------------------------------------------
D2ITA0_MCL1-02      ------------------------------------------------------------
D2ITA0_MCL1-03      ------------------------------------------------------------
                                                                                

D2ITA0_MCL1-01      DALGCTGKIANTEGINSVVKQDPFKIFPEEPPNTTNVEETVERIHNNDSGLTEVNLNNIK
D2ITA0_MCL1-04      ------------------------------------------------------------
D2ITA0_MCL1-02      ------------------------------------------------------------
D2ITA0_MCL1-03      ------------------------------------------------------------
                                                                                

D2ITA0_MCL1-01      DIPIPTLKEVFEAMKGNSYVEILSIAATRSNDPVAFACAEMLQENTSLQSLNIESNFITA
D2ITA0_MCL1-04      ------------------------------------------------------------
D2ITA0_MCL1-02      ------------------------------------------------------------
D2ITA0_MCL1-03      ------------------------------------------------------------
                                                                                

D2ITA0_MCL1-01      EGMKAVVKAMASNATLVELKIDNQRHTLGDSVEMEIAAMLENNSSILKFGYHFTQQGPRA
D2ITA0_MCL1-04      ---------------------------------MEIAAMLENNSSILKFGYHFTQQGPRA
D2ITA0_MCL1-02      ---------------------------------VEFFRVSDPETTVRNTLMAFAGFAGIG
D2ITA0_MCL1-03      ---------------------------------VEFFRVSDPETTVRNTLMAFAGFAGIG
                                                     :*:  : : :::: :    *:  .  .

D2ITA0_MCL1-01      RAAMAVTRNNDMLRQQRLR------
D2ITA0_MCL1-04      RAAMAVTRNNDMLRQQRLR------
D2ITA0_MCL1-02      ATIALLIR-----------------
D2ITA0_MCL1-03      ATIALLIRSEGQVSREKNRNLPQQT
                     :   : *                 

© 1998-2022Legal notice