Dataset for protein Mcl-1 of organism Gadus morhua

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5CE84_MCL1-04      --------------------------------------------------
A0A8C5CE84_MCL1-01      MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALPLM
A0A8C5CE84_MCL1-02      MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALPLM
A0A8C5CE84_MCL1-03      MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALPLM
                                                                          

A0A8C5CE84_MCL1-04      --------------------------------------------------
A0A8C5CE84_MCL1-01      ATFKSGDERKPRPTELGRGRLVNKSQDDQEGNGSLPSTPELQSEVDTDSQ
A0A8C5CE84_MCL1-02      ATFKSGDERKPRPTELGRGRLVNKSQDDQEGNGSLPSTPELQSEVDTDSQ
A0A8C5CE84_MCL1-03      ATFKSGDERKPRPTELGRGRLVNKSQDDQEGNGSLPSTPELQSEVDTDSQ
                                                                          

A0A8C5CE84_MCL1-04      ------------------------------MSDPRDIDEDAILKGLSSAE
A0A8C5CE84_MCL1-01      AGEEVLDNDTKRIIRIFLRDYAGASKAKRTRQDEVQVTMRRVVDGVLEKH
A0A8C5CE84_MCL1-02      AGEEVLDNDTKRIIRIFLRDYAGASKAKRTRQDEVQVTMRRVVDGVLEKH
A0A8C5CE84_MCL1-03      AGEEVLDNDTKRIIRIFLRDYAGASKAKRTRQDEVQVTMRRVVDGVLEKH
                                                       .*  ::    ::.*: .  

A0A8C5CE84_MCL1-04      LEQLECELQDLDPE------------------------------------
A0A8C5CE84_MCL1-01      QYAYKGMIQKLELDGRGEDMSFVTSVAKSLFADSTTNWGRIASLVAFGAA
A0A8C5CE84_MCL1-02      QYAYKGMIQKLELDGRGEDMSFVTSVAKSLFADSTTNWGRIASLVAFGAA
A0A8C5CE84_MCL1-03      QYAYKGMIQKLELDGRGEDMSFVTSVAKSLFADSTTNWGRIASLVAFGAA
                            :  :*.*: :                                    

A0A8C5CE84_MCL1-04      ---------------------------------------NAMLPAGYRQR
A0A8C5CE84_MCL1-01      LCQYLEARGKEGCVSLVAEEISSYLLSDQREWLVKNNSWNAMLPAGYRQR
A0A8C5CE84_MCL1-02      LCQYLEARGKEGCVSLVAEEISSYLLSDQREWLVKNNSWEGFV-------
A0A8C5CE84_MCL1-03      LCQYLEARGKEGCVSLVAEEISSYLLSDQREWLVKNNSWEGFV-------
                                                               :.::       

A0A8C5CE84_MCL1-04      DQTKKTPTGDYDRDALQDYLEKSALEHEDREDLIPFTGEKKGRKAFVPTA
A0A8C5CE84_MCL1-01      DQTKKTPTGDYDRDALQDYLEKSALEHEDREDLIPFTGEKKG-KAFVPTA
A0A8C5CE84_MCL1-02      -----------------EFFRVSDPETTVRNTLMAFAG------------
A0A8C5CE84_MCL1-03      -----------------EFFRVSDPETTVRNTLMAFAG------------
                                         :::  *  *   *: *:.*:*            

A0A8C5CE84_MCL1-04      TGQIPLSEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQYYDAL
A0A8C5CE84_MCL1-01      TGQIPLSEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQYYDAL
A0A8C5CE84_MCL1-02      ----------------------------------------------FAGI
A0A8C5CE84_MCL1-03      ----------------------------------------------FAGI
                                                                      : .:

A0A8C5CE84_MCL1-04      GCTGKIANTEGINSVVKQDPFKIFPEEPPNTTNVEETVERIHNNDSGLTE
A0A8C5CE84_MCL1-01      GCTGKIANTEGINSVVKQDPFKIFPEEPPNTTNVEETVERIHNNDSGLTE
A0A8C5CE84_MCL1-02      GAT-----------------------------------------------
A0A8C5CE84_MCL1-03      GAT-----------------------------------------------
                        *.*                                               

A0A8C5CE84_MCL1-04      VNLNNIKDIPIPTLKEVFEAMKGNSYVEILSIAATRSNDPVAFACAEMLQ
A0A8C5CE84_MCL1-01      VNLNNIKDIPIPTLKEVFEAMKGNSYVEILSIAATRSNDPVAFACAEMLQ
A0A8C5CE84_MCL1-02      --------------------------------------------------
A0A8C5CE84_MCL1-03      --------------------------------------------------
                                                                          

A0A8C5CE84_MCL1-04      ENTSLQSLNIESNFITAEGMKAVVKAMASNATLVELKIDNQRHTLGDSVE
A0A8C5CE84_MCL1-01      ENTSLQSLNIESNFITAEGMKAVVKAMASNATLVELKIDNQRHTLGDSVE
A0A8C5CE84_MCL1-02      --------------------------------------------------
A0A8C5CE84_MCL1-03      --------------------------------------------------
                                                                          

A0A8C5CE84_MCL1-04      MEIAAMLENNSSILKFGYHFTQQGPRARAAMAVTRNNDMLRQQRLR
A0A8C5CE84_MCL1-01      MEIAAMLENNSSILKFGYHFTQQGPRARAAMAVTRNNDMLRQQRLR
A0A8C5CE84_MCL1-02      --IALLI------------------R--------------------
A0A8C5CE84_MCL1-03      --IALLI------------------RSEGQVSREKNRNLPQQT---
                          ** ::                  *                    

© 1998-2022Legal notice