Dataset for protein Mcl-1 of organism Gadus morhua

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   :..*.: .*:  :.  *...    *  *         * * :.. *: *  **        
mlsqkltsnygtslvqtcwfnsPqnggEernmdfhSegshtttEgaLp--------LmAtfksgDerKprPTe-------
-------------------msd rdid dailkgl saeleql ce qdldpenam p gyrqr qt kt  gdydrdal
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   * .. * ::..:*                 ..*.:* : :  *:.*::   : . :.   *   *: ::     .:*
---LgrgrLvnksqdD---------------qegnGslPstpe--LqsEvdtdsqageevldnDtkrIirifl----rdY
qdy eksa ehedre lipftgekkgrkafvptat qi lseqit ep leealknatdaemc iaa lgmytlmsnkq 
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .*  ...* :. : :: .:..               *: .:*. :   .*: :    : ..  :. :..* ::: .:* 
agA--skaKrtrqdevqvtmrr--------------vVdgvlEkhqyaykGmiqkleldgrgedmsfvtsVakslfadSt
yd lgctg ianteginsvvkqdpfkifpeeppnttn eetv rihnnds ltevnlnnikdipiptlke feamkgn y
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.:   **:      ***..*               .::: * * :. *. :*.: :   *. :.:. . .:* :      
tnwgrIAsl-----VAFgaA--------------lcqyleArGkegcVslvAeeissylLsdqrewlvknnSwegf----
veils  atrsndp   ac emlqentslqslniesnfit e mkav kam snatlve kidnqrhtlgd vn--lpag
                                                                          am    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
yrqrdqtkktptgdydrdalqdyleksalehedredlipftgekkgkafvptatgqiplseqitlepeleealknatdae
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mcdiaailgmytlmsnkqyydalgctgkianteginsvvkqdpfkifpeeppnttnveetverihnndsgltevnlnnik
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
dipiptlkevfeamkgnsyveilsiaatrsndpvafacaemlqentslqslniesnfitaegmkavvkamasnatlvelk
                                                                                

       570       580       590       600       610       620     
....:....|....:....|....:....|....:....|....:....|....:....|....:
             :*:  : : :::: :    *:  .  . :   : *                 
-------------vEifrvsepnttvrntlyhFtqqgprgrtimlvtRnndmlrqqrlr------
idnqrhtlgdsvem faamldnessilkfgma agfagiaaaaaali -----------nlpqqt
                                                segqvsrekn       
© 1998-2022Legal notice