Dataset for protein Mcl-1 of organism Gadus morhua

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mlsqkltsnygtslvqtcwfnspqnggeernmdfhsegshtttegalplmatfksgderkprptelgrgrlvnksqddqe
--------------------------------------------------------------------------------
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                   .*  ::    ::.*: .      :  :*.
gngslpstpelqsevdtdsqageevldndtkriiriflrdyagaskakrtrqDevqvtmrrvvdGvlekhqyaykgmiQk
--------------------------------------------------ms prdidedailk lssaeleqlecel d
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*: :                                                                           :
Leldgrgedmsfvtsvakslfadsttnwgriaslvafgaalcqyleargkegcvslvaeeissyllsdqrewlvknnswn
 dpe---------------------------------------------------------------------------e
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.::                        :::  *  *   *: *:.*:*                                
gmv------------------------eylrvSdpEttvRntLmpFtG--------------------------------
aflpagyrqrdqtkktptgdydrdalqdffek al hed ed ia a ekkgrkafvptatgqiplseqitlepeleeal
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          : .:*.*                                               
--------------------------ydglGcT-----------------------------------------------
knatdaemcdiaailgmytlmsnkqyfaai a gkianteginsvvkqdpfkifpeeppnttnveetverihnndsglte
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vnlnnikdipiptlkevfeamkgnsyveilsiaatrsndpvafacaemlqentslqslniesnfitaegmkavvkamasn
                                                                                

       490       500       510       520       530       540      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
                      ** ::                  *                    
----------------------IAlml------------------Raraamavtrnndmlrqq---
atlvelkidnqrhtlgdsveme  aliennssilkfgyhftqqgp -----------------rlr
                                              segqvsrek rnlpq t   
© 1998-2022Legal notice