Dataset for protein BCL-2-like of organism Esox lucius

[Download (right click)] [Edit] [Sequences] [Repertoires]

15 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8Y1W8_MCL1-01      --------------------LSYSYRQNMSKSDPRDIDEDAILKGMSAEE
A0A3P8Y1W8_MCL1-03      -----------------------EACLYMSKSDPRDIDEDAILKGMSAEE
A0A3P8Y1W8_MCL1-02      -------------------------LADMSKSDPRDIDEDAILKGMSAEE
A0A3P8Y1W8_MCL1-04      MNLSKSLTRATTTMLNVQNGVVGSLYSGAPLCYFSPTGPLCPAASSKSKM
A0A3P8Y1W8_MCL1-05      MNLSKSLTRATTTMLNVQNGVVGSLYSGAPLCYFSPTGPLCPAASSKSKM
A0A6Q2YIU6_BCL2-01      --------------------------------------------------
A0A6Q2YT18_MCL1-01      --------------------------------------------------
A0A6Q2XQM7_MCL1-01      --------------------------------------------------
A0A6Q2YT18_MCL1-02      --------------------------------------------------
A0A6Q2XQM7_MCL1-02      --------------------------------------------------
A0A6Q2XXK6_MCL1-01      ---------------MSGVYPQGSNFTSRVTVTVKGFGISALKRRESGQY
A0A6Q2Y9Q3_MCL1-01      ---------------MSGVYPQGSNFTSRVTVTVKGFGISALKRRESGQY
A0A3P8XYL5_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
                                                                          

A0A3P8Y1W8_MCL1-01      LDALEYELQEMDPENAMLPAGFRQRDQTKKSPTGVFDRD--------ALL
A0A3P8Y1W8_MCL1-03      LDALEYELQEMDPENAMLPAGFRQRDQTKKSPTGVFDRD--------ALL
A0A3P8Y1W8_MCL1-02      LDALEYELQEMDPENAMLPAGFRQRDQTKKSPTGVFDRD--------ALL
A0A3P8Y1W8_MCL1-04      DVDLGNGTADTPVRPTKLEVNMTKPNVLDSRLSDLADDSDDSLPCTPLMV
A0A3P8Y1W8_MCL1-05      DVDLGNGTADTPVRPTKLEVNMTKPNVLDSRLSDLADDSDDSLPCTPLMV
A0A6Q2YIU6_BCL2-01      ----MADDDNRFIVEKYICHKLLKRGY--------------------AWD
A0A6Q2YT18_MCL1-01      ------------------MRVFSKSKM--------------------SLI
A0A6Q2XQM7_MCL1-01      ------------------MRVFSKSKM--------------------SLI
A0A6Q2YT18_MCL1-02      ------------------MRVFSKSKM--------------------SLI
A0A6Q2XQM7_MCL1-02      ----CLECHV-----PYAVYLFSKSKM--------------------SLI
A0A6Q2XXK6_MCL1-01      ESPEGLKSHTGPDVDTIRILVFSKQKM--------------------SLI
A0A6Q2Y9Q3_MCL1-01      ESPEGLKSHTGPDVDTIRILVFSKQKM--------------------SLI
A0A3P8XYL5_BCL2L1-      ----IMTYNNKELVAYYITYKLSQRNY--------------------PIN
A0A3P8XFS0_BCL2L1-      -----MSYSNRELVVFFINYKLSQRNY--------------------SCC
A0A3P8XFS0_BCL2L1-      -----MSYSNRELVVFFINYKLSQRNY--------------------SCC
                                             : :                          

A0A3P8Y1W8_MCL1-01      DHLEKTALEHADREDLVPFTGEKKGRAFVPKEGHGQIPINEQIT------
A0A3P8Y1W8_MCL1-03      DHLEKTALEHADREDLVPFTGEKKGRAFVPKEGHGQIPINEQIT------
A0A3P8Y1W8_MCL1-02      DHLEKTALEHADREDLVPFTGEKKGRAFVPKEGHGQIPINEQIT------
A0A3P8Y1W8_MCL1-04      TECSAGLSHCPSGNEVLDNDTRQLIENLLRDYTGLSQPRWKQNK------
A0A3P8Y1W8_MCL1-05      TECSAGLSHCPSGNEVLDNDTRQLIENLLRDYTGLSQPRWKQNK------
A0A6Q2YIU6_BCL2-01      FEDAEE--EDGANNGSMISPPPGLVRRIHGASKAGQGSVPHISKWLSQPD
A0A6Q2YT18_MCL1-01      SQGTGECVDECRNRASLDTETRQLVKSFLGDFTEHLKPRWNESK------
A0A6Q2XQM7_MCL1-01      SQGTGECVDECRNRASLDTETRQLVKSFLGDFTEHLKPRWNESK------
A0A6Q2YT18_MCL1-02      SQGTGECVDECRNRASLDTETRQLVKSFLGDFTEHLKPRWNESK------
A0A6Q2XQM7_MCL1-02      SQGTGECVDECRNRASLDTETRQLVKSFLGDFTEHLKPRWNESK------
A0A6Q2XXK6_MCL1-01      SQGTGECIYERRNRASLDTETRQLVKSFLEEFTGCLKPRCNESK------
A0A6Q2Y9Q3_MCL1-01      SQGTGECIYKRRNRASLDTETRQLVKSFLEEFTGCLKPRCNESK------
A0A3P8XYL5_BCL2L1-      HTGLTGAFDRTEGGEVEEVAAVTMHPNGTMNGTSPGTPTQQSPPSSPRRT
A0A3P8XFS0_BCL2L1-      ELELEGASGRTEGEEATANGSVGNGRNSRRNLGKPSTPQG----------
A0A3P8XFS0_BCL2L1-      ELELEGASGRTEGEEATANGSVGNGRNSRRNLGKPSTPQG----------
                                                             .            

A0A3P8Y1W8_MCL1-01      -LEPELEEALKNATDAEMCDIAAILGMYTLMSNKQYYDALGTTGTIANTE
A0A3P8Y1W8_MCL1-03      -LEPELEEALKNATDAEMCDIAAILGMYTLMSNKQYYDALGTTGTIANTE
A0A3P8Y1W8_MCL1-02      -LEPELEEALKNATDAEMCDIAAILGMYTLMSNKQYYDALGTTGTIANTE
A0A3P8Y1W8_MCL1-04      -SLVTMKRVVGDVIAKHTYAYKGMISKLC---LDDQGDDMGFITSVAK--
A0A3P8Y1W8_MCL1-05      -SLVTMKRVVGDVIAKHTYAYKGMISKLC---LDDQGDDMGFITSVAK--
A0A6Q2YIU6_BCL2-01      -PHAAIHRVLREAGDELERLYQPDFLEMSHQLYLTSSVAERRFREVID--
A0A6Q2YT18_MCL1-01      -ALSTMKQVVTKSLDKHRYSYNGMLYRLS--LGDSPGDYVRFVSVIAN--
A0A6Q2XQM7_MCL1-01      -ALSTMKQVVTKSLDKHRYSYNGMLYRLS--LGDSPGDYVRFVSVIAN--
A0A6Q2YT18_MCL1-02      -ALSTMKQVVTKSLDKHRYSYNGMLYRLS--LGDSPGDYVRFVSVIAN--
A0A6Q2XQM7_MCL1-02      -ALSTMKQVVTKSLDKHRYSYNGMLYRLS--LGDSPGDYVRFVSVIAN--
A0A6Q2XXK6_MCL1-01      -ALSTMKRVVTETLDKHRYSYNGMLYTLS--LDDSTGHDVGFVGVVAN--
A0A6Q2Y9Q3_MCL1-01      -ALSTMKRVVTETLDKHRYSYNGMLYTLS--LDDSTGHDVGFVGVVAN--
A0A3P8XYL5_BCL2L1-      VGLDAVKEALRDSANEFELRYALAFSDLSSQLHLTPATAYQSFASVMD--
A0A3P8XFS0_BCL2L1-      -CMEAVKAALRDSADEFELRYTRAFSDLSSQLHITPATAYHSFESVMD--
A0A3P8XFS0_BCL2L1-      -CMEAVKAALRDSADEFELRYTRAFSDLSSQLHITPATAYHSFESVMD--
                             :  .: .            :                    : .  

A0A3P8Y1W8_MCL1-01      GINSVVKPDPFKIFPDEPPNPTNVEETLQQIQTNDSSLLEVNLNNIKDIP
A0A3P8Y1W8_MCL1-03      GINSVVKPDPFKIFPDEPPNPTNVEETLQQIQTNDSSLLEVNLNNIKDIP
A0A3P8Y1W8_MCL1-02      GINSVVKPDPFKIFPDEPPNPTNVEETLQQIQTNDSSLLEVNLNNIKDIP
A0A3P8Y1W8_MCL1-04      -----------SLFSDGTTNWGRIASLV----------------------
A0A3P8Y1W8_MCL1-05      -----------SLFSDGTTNWGRIASLV----------------------
A0A6Q2YIU6_BCL2-01      -----------ELFRDGV-NWGRIIAFF----------------------
A0A6Q2YT18_MCL1-01      -----------RLFADGTTNWGRVISLL----------------------
A0A6Q2XQM7_MCL1-01      -----------RLFADGTTNWGRVVSLL----------------------
A0A6Q2YT18_MCL1-02      -----------RLFADGTTNWGRVISLL----------------------
A0A6Q2XQM7_MCL1-02      -----------RLFADGTTNWGRVVSLL----------------------
A0A6Q2XXK6_MCL1-01      -----------RLFADGVTNWGRVVSLL----------------------
A0A6Q2Y9Q3_MCL1-01      -----------RLFADGVTNWGRVVSLL----------------------
A0A3P8XYL5_BCL2L1-      -----------EVFRDGV-NWGRVVGLF----------------------
A0A3P8XFS0_BCL2L1-      -----------EVFRDGV-NWGRVVGLF----------------------
A0A3P8XFS0_BCL2L1-      -----------EVFRDGV-NWGRVVGLF----------------------
                                    :* *   *  .:   .                      

A0A3P8Y1W8_MCL1-01      IPTLKEIFEAMKTNTHVESLSIAATRSNDPVAFAVAEMLQENTTLQSLNI
A0A3P8Y1W8_MCL1-03      IPTLKEIFEAMKTNTHVESLSIAATRSNDPVAFAVAEMLQENTTLQSLNI
A0A3P8Y1W8_MCL1-02      IPTLKEIFEAMKTNTHVESLSIAATRSNDPVAFAVAEMLQENTTLQSLNI
A0A3P8Y1W8_MCL1-04      -----------------------------GFGAVVSQHLKEMGKGNCVEL
A0A3P8Y1W8_MCL1-05      -----------------------------GFGAVVSQHLKEMGKGNCVEL
A0A6Q2YIU6_BCL2-01      -----------------------------EFGGTICVECVNKEMTSQVDH
A0A6Q2YT18_MCL1-01      -----------------------------AFGTVVCRYLKDKGKDNCVEA
A0A6Q2XQM7_MCL1-01      -----------------------------AFGTVVCRYLKDKGKDNCVEA
A0A6Q2YT18_MCL1-02      -----------------------------AFGTVVCRYLKDKGKDNCVEA
A0A6Q2XQM7_MCL1-02      -----------------------------AFGTVVCRYLKDKGKDNCVEA
A0A6Q2XXK6_MCL1-01      -----------------------------AFGAAVCRYLKDKGKENCVEA
A0A6Q2Y9Q3_MCL1-01      -----------------------------AFGAAVCRYLKDKGKENCVEA
A0A3P8XYL5_BCL2L1-      -----------------------------AFGGALCVECVEKEMSPLVGR
A0A3P8XFS0_BCL2L1-      -----------------------------AFGGALCVECVEKDMSLLVAR
A0A3P8XFS0_BCL2L1-      -----------------------------AFGGALCVECVEKDMSLLVAR
                                                      .. .:.    :      :  

A0A3P8Y1W8_MCL1-01      ESNFITSEGMTAIVKAMANNNTLTEIKIDNQRQKLGDSCEMEIASMLENN
A0A3P8Y1W8_MCL1-03      ESNFITSEGMTAIVKAMANNNTLTEIKIDNQRQKLGDSCEMEIASMLENN
A0A3P8Y1W8_MCL1-02      ESNFITSEGMTAIVKAMANNNTLTEIKIDNQRQKLGDSCEMEIASMLENN
A0A3P8Y1W8_MCL1-04      VGQEISTYLLTDQRAWLVKNNAWDGF--------------VEFFHVEDPE
A0A3P8Y1W8_MCL1-05      VGQEISTYLLTDQRAWLVKNNAWDGF--------------VEFFHVEDPE
A0A6Q2YIU6_BCL2-01      IAGWMTEYLNGPLHSWIQENGGWEAF--------------VELYDRQR-D
A0A6Q2YT18_MCL1-01      VGQEISMYLLTDQRDWLVKNNSWDGF--------------VEFFRVAE-E
A0A6Q2XQM7_MCL1-01      VGQEISMYLLTDQRDWLVKNNSWDGF--------------VEFFRVAE-E
A0A6Q2YT18_MCL1-02      VGQEISMYLLTDQRDWLVKNNSWDGF--------------VEFFRVAE-E
A0A6Q2XQM7_MCL1-02      VGQEISMYLLTDQRDWLVKNNSWDGF--------------VEFFRVAE-E
A0A6Q2XXK6_MCL1-01      VGQEISMHLLTDHKDWLVKNNSWDGF--------------VEFFRVAE-E
A0A6Q2Y9Q3_MCL1-01      VGQEISMHLLTDHKDWLVKNNSWDGF--------------VEFFRVAE-E
A0A3P8XYL5_BCL2L1-      IADWMTVYLDNHIQPWIESQGGWDRF--------------AEIFGKDA-A
A0A3P8XFS0_BCL2L1-      IADWMTTYLDEHIQPWIQIQGGWDRF--------------ADIFGRDA-A
A0A3P8XFS0_BCL2L1-      IADWMTTYLDEHIQPWIQIQGGWDRF--------------ADIFGRDA-A
                         .  ::          :  :.    :               ::       

A0A3P8Y1W8_MCL1-01      SSILKIGYHFTQQGPRARAAIAITRNNDLI------------RQQRLR
A0A3P8Y1W8_MCL1-03      SSILKIGYHFTQQGPRARAAIAITRNNDLSEHL---------------
A0A3P8Y1W8_MCL1-02      SSILKIGYHFTQQGPRARAAIAITRNNDLIVYGFPTCDDLSHRRFSFT
A0A3P8Y1W8_MCL1-04      SSVRNTLMAFAGVAGIGATLALLIRQSPAHPWGCEACLCDPS------
A0A3P8Y1W8_MCL1-05      SSVRNTLMAFAGVAGIGATLALLIR-----------------------
A0A6Q2YIU6_BCL2-01      SVFCSWPSIKTVFGLAALGAASLTIGAYLTQK----------------
A0A6Q2YT18_MCL1-01      STLRNVLLTFDVVYTLWIRFS---------------------------
A0A6Q2XQM7_MCL1-01      STLRNVLLTFAGFGAALAMLKMVG------YQ----------------
A0A6Q2YT18_MCL1-02      STLRNVLLTFAGFRAALAMLKMYVVTGKNLYM----------------
A0A6Q2XQM7_MCL1-02      STLRNVLLTFAGFGAALAMLKMYVVTGKSLYM----------------
A0A6Q2XXK6_MCL1-01      STLRNVLVTFAAFAGFWAALVMLDM-----------------------
A0A6Q2Y9Q3_MCL1-01      STLRNVLVTFAAFAVSMVHYIRAVY-----------------------
A0A3P8XYL5_BCL2L1-      ANSRKSQESFKKWLLAGMTLVTGVVVGSLIAQKRL-------------
A0A3P8XFS0_BCL2L1-      ADIRRSQESLRKWLLFGVMLLSGVLVGTLLMKKRQ-------------
A0A3P8XFS0_BCL2L1-      ADIRRSQESLRKWLLFG-------------MENAQWT-----------
                        :                                               

© 1998-2022Legal notice