Dataset for protein BCL-2-like of organism Esox lucius

[Download (right click)] [Edit] [Sequences] [Repertoires]

15 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6Q2YT18_MCL1-01      --------------------------------------------------
A0A6Q2XQM7_MCL1-01      --------------------------------------------------
A0A6Q2YT18_MCL1-02      --------------------------------------------------
A0A6Q2YIU6_BCL2-01      ---------------------------------------MADDDNRFIVE
A0A6Q2XQM7_MCL1-02      ---------------------------------------CLECHV-----
A0A6Q2XXK6_MCL1-01      MSGVYPQGSNFTSRVTVTVKGFGISALKRRESGQYESPEGLKSHTGPDVD
A0A6Q2Y9Q3_MCL1-01      MSGVYPQGSNFTSRVTVTVKGFGISALKRRESGQYESPEGLKSHTGPDVD
A0A3P8XYL5_BCL2L1-      ---------------------------------------IMTYNNKELVA
A0A3P8XFS0_BCL2L1-      ----------------------------------------MSYSNRELVV
A0A3P8XFS0_BCL2L1-      ----------------------------------------MSYSNRELVV
A0A3P8Y1W8_MCL1-05      ------MNLSKSLTRATT--------------------TMLNVQNGVVGS
A0A3P8Y1W8_MCL1-04      ------MNLSKSLTRATT--------------------TMLNVQNGVVGS
A0A3P8Y1W8_MCL1-01      LSYSYRQNMSKSDPRDIDEDAILKGMSAEELDALEYELQEMDPENAMLPA
A0A3P8Y1W8_MCL1-03      ---EACLYMSKSDPRDIDEDAILKGMSAEELDALEYELQEMDPENAMLPA
A0A3P8Y1W8_MCL1-02      -----LADMSKSDPRDIDEDAILKGMSAEELDALEYELQEMDPENAMLPA
                                                                          

A0A6Q2YT18_MCL1-01      ---MRVFSKSK---------------------------------------
A0A6Q2XQM7_MCL1-01      ---MRVFSKSK---------------------------------------
A0A6Q2YT18_MCL1-02      ---MRVFSKSK---------------------------------------
A0A6Q2YIU6_BCL2-01      KYICHKLLKRG---------------------------------------
A0A6Q2XQM7_MCL1-02      PYAVYLFSKSK---------------------------------------
A0A6Q2XXK6_MCL1-01      TIRILVFSKQK---------------------------------------
A0A6Q2Y9Q3_MCL1-01      TIRILVFSKQK---------------------------------------
A0A3P8XYL5_BCL2L1-      YYITYKLSQRN---------------------------------------
A0A3P8XFS0_BCL2L1-      FFINYKLSQRN---------------------------------------
A0A3P8XFS0_BCL2L1-      FFINYKLSQRN---------------------------------------
A0A3P8Y1W8_MCL1-05      LYSGAPLCYFSPTG----------------------PLCPAASSKSKMDV
A0A3P8Y1W8_MCL1-04      LYSGAPLCYFSPTG----------------------PLCPAASSKSKMDV
A0A3P8Y1W8_MCL1-01      GFRQRDQTKKSPTGVFDRDALLDHLEKTALEHADREDLVPFTGEKKGRAF
A0A3P8Y1W8_MCL1-03      GFRQRDQTKKSPTGVFDRDALLDHLEKTALEHADREDLVPFTGEKKGRAF
A0A3P8Y1W8_MCL1-02      GFRQRDQTKKSPTGVFDRDALLDHLEKTALEHADREDLVPFTGEKKGRAF
                                                                          

A0A6Q2YT18_MCL1-01      --------------------------------------------------
A0A6Q2XQM7_MCL1-01      --------------------------------------------------
A0A6Q2YT18_MCL1-02      --------------------------------------------------
A0A6Q2YIU6_BCL2-01      --------------------------------------------------
A0A6Q2XQM7_MCL1-02      --------------------------------------------------
A0A6Q2XXK6_MCL1-01      --------------------------------------------------
A0A6Q2Y9Q3_MCL1-01      --------------------------------------------------
A0A3P8XYL5_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8XFS0_BCL2L1-      --------------------------------------------------
A0A3P8Y1W8_MCL1-05      DLGNGTADTPVRPT---KLEVNMTKPNVLDSRLSDLA-------------
A0A3P8Y1W8_MCL1-04      DLGNGTADTPVRPT---KLEVNMTKPNVLDSRLSDLA-------------
A0A3P8Y1W8_MCL1-01      VPKEGHGQIPINEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQ
A0A3P8Y1W8_MCL1-03      VPKEGHGQIPINEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQ
A0A3P8Y1W8_MCL1-02      VPKEGHGQIPINEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQ
                                                                          

A0A6Q2YT18_MCL1-01      -------------------------MSLISQGTGECVDECRNRASLDTET
A0A6Q2XQM7_MCL1-01      -------------------------MSLISQGTGECVDECRNRASLDTET
A0A6Q2YT18_MCL1-02      -------------------------MSLISQGTGECVDECRNRASLDTET
A0A6Q2YIU6_BCL2-01      -------------------------YAWDFEDAEEEDGANNGSMISPPPG
A0A6Q2XQM7_MCL1-02      -------------------------MSLISQGTGECVDECRNRASLDTET
A0A6Q2XXK6_MCL1-01      -------------------------MSLISQGTGECIYERRNRASLDTET
A0A6Q2Y9Q3_MCL1-01      -------------------------MSLISQGTGECIYKRRNRASLDTET
A0A3P8XYL5_BCL2L1-      -------------------------YPINHTGLTGAFDRTEGGEVEEVAA
A0A3P8XFS0_BCL2L1-      -------------------------YSCCELELEGASGRTEGEEATANGS
A0A3P8XFS0_BCL2L1-      -------------------------YSCCELELEGASGRTEGEEATANGS
A0A3P8Y1W8_MCL1-05      --------------DDSDDSLPCTPL-MVTECSAGLSHCPSGNEVLDNDT
A0A3P8Y1W8_MCL1-04      --------------DDSDDSLPCTPL-MVTECSAGLSHCPSGNEVLDNDT
A0A3P8Y1W8_MCL1-01      YYDALGTTGTIANTEGINSVVKPDPFKIFPDEPPNPTNVEETLQQIQTND
A0A3P8Y1W8_MCL1-03      YYDALGTTGTIANTEGINSVVKPDPFKIFPDEPPNPTNVEETLQQIQTND
A0A3P8Y1W8_MCL1-02      YYDALGTTGTIANTEGINSVVKPDPFKIFPDEPPNPTNVEETLQQIQTND
                                                                          

A0A6Q2YT18_MCL1-01      RQLVKSFLGDFTEHLKPRWNESK-------ALSTMKQVVTKSLDKHRYSY
A0A6Q2XQM7_MCL1-01      RQLVKSFLGDFTEHLKPRWNESK-------ALSTMKQVVTKSLDKHRYSY
A0A6Q2YT18_MCL1-02      RQLVKSFLGDFTEHLKPRWNESK-------ALSTMKQVVTKSLDKHRYSY
A0A6Q2YIU6_BCL2-01      LVRRIHGASKAGQGSVPHISKWLSQPD---PHAAIHRVLREAGDELERLY
A0A6Q2XQM7_MCL1-02      RQLVKSFLGDFTEHLKPRWNESK-------ALSTMKQVVTKSLDKHRYSY
A0A6Q2XXK6_MCL1-01      RQLVKSFLEEFTGCLKPRCNESK-------ALSTMKRVVTETLDKHRYSY
A0A6Q2Y9Q3_MCL1-01      RQLVKSFLEEFTGCLKPRCNESK-------ALSTMKRVVTETLDKHRYSY
A0A3P8XYL5_BCL2L1-      VTMHPNGTMNGTSPGTPTQQSPPSSPRRTVGLDAVKEALRDSANEFELRY
A0A3P8XFS0_BCL2L1-      VGNGRNSRRNLGKPSTPQG-----------CMEAVKAALRDSADEFELRY
A0A3P8XFS0_BCL2L1-      VGNGRNSRRNLGKPSTPQG-----------CMEAVKAALRDSADEFELRY
A0A3P8Y1W8_MCL1-05      RQLIENLLRDYTGLSQPRWKQNK-------SLVTMKRVVGDVIAKHTYAY
A0A3P8Y1W8_MCL1-04      RQLIENLLRDYTGLSQPRWKQNK-------SLVTMKRVVGDVIAKHTYAY
A0A3P8Y1W8_MCL1-01      SSLLEVNLNNIKDIPIPTLKE-----------------IFEAMKTNTH--
A0A3P8Y1W8_MCL1-03      SSLLEVNLNNIKDIPIPTLKE-----------------IFEAMKTNTH--
A0A3P8Y1W8_MCL1-02      SSLLEVNLNNIKDIPIPTLKE-----------------IFEAMKTNTH--
                                 .      *                     : .         

A0A6Q2YT18_MCL1-01      NGMLYRLS--LGDSPGDYVRFVSVIANRLFADGTTNWGRVISLLAFGTVV
A0A6Q2XQM7_MCL1-01      NGMLYRLS--LGDSPGDYVRFVSVIANRLFADGTTNWGRVVSLLAFGTVV
A0A6Q2YT18_MCL1-02      NGMLYRLS--LGDSPGDYVRFVSVIANRLFADGTTNWGRVISLLAFGTVV
A0A6Q2YIU6_BCL2-01      QPDFLEMSHQLYLTSSVAERRFREVIDELFRDGV-NWGRIIAFFEFGGTI
A0A6Q2XQM7_MCL1-02      NGMLYRLS--LGDSPGDYVRFVSVIANRLFADGTTNWGRVVSLLAFGTVV
A0A6Q2XXK6_MCL1-01      NGMLYTLS--LDDSTGHDVGFVGVVANRLFADGVTNWGRVVSLLAFGAAV
A0A6Q2Y9Q3_MCL1-01      NGMLYTLS--LDDSTGHDVGFVGVVANRLFADGVTNWGRVVSLLAFGAAV
A0A3P8XYL5_BCL2L1-      ALAFSDLSSQLHLTPATAYQSFASVMDEVFRDGV-NWGRVVGLFAFGGAL
A0A3P8XFS0_BCL2L1-      TRAFSDLSSQLHITPATAYHSFESVMDEVFRDGV-NWGRVVGLFAFGGAL
A0A3P8XFS0_BCL2L1-      TRAFSDLSSQLHITPATAYHSFESVMDEVFRDGV-NWGRVVGLFAFGGAL
A0A3P8Y1W8_MCL1-05      KGMISKLC---LDDQGDDMGFITSVAKSLFSDGTTNWGRIASLVGFGAVV
A0A3P8Y1W8_MCL1-04      KGMISKLC---LDDQGDDMGFITSVAKSLFSDGTTNWGRIASLVGFGAVV
A0A3P8Y1W8_MCL1-01      ---VESLS---IAATRSNDPVAFAVAEMLQENTTLQSLNIESNFITSEGM
A0A3P8Y1W8_MCL1-03      ---VESLS---IAATRSNDPVAFAVAEMLQENTTLQSLNIESNFITSEGM
A0A3P8Y1W8_MCL1-02      ---VESLS---IAATRSNDPVAFAVAEMLQENTTLQSLNIESNFITSEGM
                           .  :.                : . :  : . :  .: . .  .  :

A0A6Q2YT18_MCL1-01      CRYLKDKGKDNCVEAVGQEISMYLLTDQRDWLVKNNSWDGFVEFFRV-AE
A0A6Q2XQM7_MCL1-01      CRYLKDKGKDNCVEAVGQEISMYLLTDQRDWLVKNNSWDGFVEFFRV-AE
A0A6Q2YT18_MCL1-02      CRYLKDKGKDNCVEAVGQEISMYLLTDQRDWLVKNNSWDGFVEFFRV-AE
A0A6Q2YIU6_BCL2-01      CVECVNKEMTSQVDHIAGWMTEYLNGPLHSWIQENGGWEAFVELYDR-QR
A0A6Q2XQM7_MCL1-02      CRYLKDKGKDNCVEAVGQEISMYLLTDQRDWLVKNNSWDGFVEFFRV-AE
A0A6Q2XXK6_MCL1-01      CRYLKDKGKENCVEAVGQEISMHLLTDHKDWLVKNNSWDGFVEFFRV-AE
A0A6Q2Y9Q3_MCL1-01      CRYLKDKGKENCVEAVGQEISMHLLTDHKDWLVKNNSWDGFVEFFRV-AE
A0A3P8XYL5_BCL2L1-      CVECVEKEMSPLVGRIADWMTVYLDNHIQPWIESQGGWDRFAEIFGK-DA
A0A3P8XFS0_BCL2L1-      CVECVEKDMSLLVARIADWMTTYLDEHIQPWIQIQGGWDRFADIFGR-DA
A0A3P8XFS0_BCL2L1-      CVECVEKDMSLLVARIADWMTTYLDEHIQPWIQIQGGWDRFADIFGR-DA
A0A3P8Y1W8_MCL1-05      SQHLKEMGKGNCVELVGQEISTYLLTDQRAWLVKNNAWDGFVEFFHVEDP
A0A3P8Y1W8_MCL1-04      SQHLKEMGKGNCVELVGQEISTYLLTDQRAWLVKNNAWDGFVEFFHVEDP
A0A3P8Y1W8_MCL1-01      TAIVKAMANNNTLTEIKIDNQRQKLGDSCE-----------MEIASMLEN
A0A3P8Y1W8_MCL1-03      TAIVKAMANNNTLTEIKIDNQRQKLGDSCE-----------MEIASMLEN
A0A3P8Y1W8_MCL1-02      TAIVKAMANNNTLTEIKIDNQRQKLGDSCE-----------MEIASMLEN
                                    :  :                          ::      

A0A6Q2YT18_MCL1-01      ESTLRNVLLTFDVVYTLWIRFS---------------------------
A0A6Q2XQM7_MCL1-01      ESTLRNVLLTFAGFGAALAMLKMVG------YQ----------------
A0A6Q2YT18_MCL1-02      ESTLRNVLLTFAGFRAALAMLKMYVVTGKNLYM----------------
A0A6Q2YIU6_BCL2-01      DSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK----------------
A0A6Q2XQM7_MCL1-02      ESTLRNVLLTFAGFGAALAMLKMYVVTGKSLYM----------------
A0A6Q2XXK6_MCL1-01      ESTLRNVLVTFAAFAGFWAALVMLDM-----------------------
A0A6Q2Y9Q3_MCL1-01      ESTLRNVLVTFAAFAVSMVHYIRAVY-----------------------
A0A3P8XYL5_BCL2L1-      AANSRKSQESFKKWLLAGMTLVTGVVVGSLIAQKRL-------------
A0A3P8XFS0_BCL2L1-      AADIRRSQESLRKWLLFG-------------MENAQWT-----------
A0A3P8XFS0_BCL2L1-      AADIRRSQESLRKWLLFGVMLLSGVLVGTLLMKKRQ-------------
A0A3P8Y1W8_MCL1-05      ESSVRNTLMAFAGVAGIGATLALLIR-----------------------
A0A3P8Y1W8_MCL1-04      ESSVRNTLMAFAGVAGIGATLALLIRQSPAHPWGCEACLCDPS------
A0A3P8Y1W8_MCL1-01      NSSILKIGYHFTQQGPRARAAIAITRNNDLI------------RQQRLR
A0A3P8Y1W8_MCL1-03      NSSILKIGYHFTQQGPRARAAIAITRNNDLSEHL---------------
A0A3P8Y1W8_MCL1-02      NSSILKIGYHFTQQGPRARAAIAITRNNDLIVYGFPTCDDLSHRRFSFT
                         :                                               

© 1998-2022Legal notice