Dataset for protein BCL-2-like of organism Esox lucius

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------md--n--lv--yrqrvlsksk-------------------
msgvypqnmsksdprditedailkgmsaeeldaleyelqml-yh-gm--agfimykftqrsptgvfdrdalldhlektal
l ysarmgsnftstvtvdvkgfgisalkrresgqyespte-spetrevpvt--nldqcykn                   
   e llyl   lr at                     eganvsvavdgslisiap l qg                   
     cad                               i ksq kpi df aghl   f                    
                                       c tdn  f  ey  v                          
                                         ecd      p  t                          
                                                  k  c                          

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ehadredlvpftgekkgrafvpkeghgqipineqitlepeleealknatdaemcdiaailgmytlmsnkqyydalgttgt
      p c aass skmdvdlgn tadt vrpt   kl vnmtkp vl srls l                        
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                 .      *                     : 
---------------mslisqgtgecvdecrnrasldtetrqlvksflrnftghlkPrwnesk-------alstmkrvvt
ianteginsvvkpdpykifpeeppgpsnvtegleviqnndvsnlennrgdikepst tlk---ssprrtv---a--q-lr
    ddsddslpct f-mvtdclenatgrestnqqtavgssgrirvstneygdipi qg-qnp q d   smv-vh-aif
               lpcceldsa liycrn emasppdglvmgphlaekl klgq hcsswl       che i a  g
                awnht at efhkp  s iee pa t ri g s g sc v  qqkp        p d   e   
                  df      d an  g     a    h    m a qg    i           g a       
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.            .  :.                : . :  : . :  .: . .  .  :            :  :    
esldkhrysyngmlyrLs--lgdspgdyvrfvsvvanrlfadgttnwgrvvslfafgtvvcrylkdkgkdncveavgqei
damkentl-----fssmcsq-iattrtdygvffsimdevqrntv-qslniignlitsgamtvecvemamsltltriaiwm
kvaatfehr traved  h  hlaqasadpsata iem  e   l     eafv aglsaiv a ennsl ae kddn
 tin l ra kpdilt     lidsshnmhrige  ks  s         a    eti qh  n d gpq gl  g  
  g     l ql   k     d    v eq  e                                    e   dh     
          a    e     y          r                                    t          
                                a                                               
                                                                                

       330       340       350       360       370       380       390         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
                      ::       :                                               
smylltdqrdwlvknnswdgfveffrv-aeestlrnvlltfagfglagamlimlvr-----------------------
ttqkdghsqp-i---gg----mdiasrldnnasilksqysltqwapraraakait-ngdllyqkrqwcldlssrrqslt
qrh nepice -qiq-- er a lygmeeaa dvcrigehkrkvlgflvt-a---vvnksimmgfpttdcdph qfrfr
 v   n hka  es  a  a     hk qpd vs stpva kvqyaiw--yvsyiytsyntvkncla            
 e     lhs   e           d   r  nf  w mi da rvsmmrf-lggmqatasqylae             
                                      s      tl lh stvdlg s hpw                
                                                ig lra i  p  eh                
                                                             ae                
© 1998-2022Legal notice