Dataset for protein BCL-2-like of organism Esox lucius

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                       : :      
--------------------------------------------------------e--n---v-t-lpyvfskrkm---
mnlsksltratttmlnvqvyvvgsnytsmsksdprdigedailkgmsaeeldalgy-yq-rpp-n-yimrklrqsnytkk
               msgngpqyelfsgrvtvyvsptdpscpkrssksqyevpeemslhemelevam-nagmt qdqlds
                    ls  yrqyaplctfkgf il laare gkmdsd mlktsttdvrpfkrivn l pgv   
                        alln                          ingsadgfd dyiaell         
                         cad                          catdnvk i epf vh          
                                                        dcd     ak  t           
                                                                    c           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                         .                 :  .:
-----------------slisqgtgecvdecrnrasldtetrqlvrsflgdftghlkPrwnesk-------alstmkrvv
sptgvfdrdddslpctpamldhllkgasertegeevvpntgvkkgknsvrnegegstsineqitwssrrtvlepaveqal
rlsdla ds        lcvteeeetllyhadrndltafgsegniealrpkykhpqi qg----slpqpd smvelhe  
                 pwcelcsa -ihcrs ggamivdpptmhpriteel klgq vcksnp       che i a  
                  inhtdat  -gkpa    eespa      ghmas sc g tqqip        p d      
                   df      f dg        a           g a     ph          g a      
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .            :                    : .              :* *   *  .:   .            
tdsldkhrysyngmlyrls--lgdspgdavgfvgvvan-------------rlFaDgvtNwgrvvsll------------
rkataefelriaaifsmytsqsnktyytyyrtfssimdteginsvvkpdpfev r et- ptniigtfqqiqtndsslle
knvanaemcd traigdmclm-hlqtahdlhsttt ik             ki p  pp     eefv            
geti  ltra kpd lt  h  lidqsv mqriee                s  s         aa              
   g     l ql   k     d  s   e   r                                              
                e     y          a                                              
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        .. .:.    :      :   .  ::          :  :
---------------------------------------afgtavcrylkekgkdncveavgqeismylltdqrdwlvkn
vnlnnikdipiptlkeifeamktnthveslsiaatrsndpvagvlavecvdntmsqslnrianwmttegmehivpaiqnq
                                       g  atisem qnmetlll aiesdf  sh dnahqk mai 
                                       e  f   qh    d gsq gl    v  ngplka  es 
                                                      ep  dh      e      hs   e 
                                                      t                         
                                                                                
                                                                                

       330       340       350       360       370       380       390        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
.    :               ::       :                                               
nswdgf--------------veffrvae-estlrnvlltfagfglagamlimlvr-----------------------
ggltrikidnqrqklgdscemdiasrlannasilksqysltqwapraraakait-ngdllyqkrqwcldlssrrqslt
 t ee               a lygmddpa dvcrigehkrkvlgflvt-a---vvnksimmgfpttdcdph qfrfr
 a  a                   hker d vs stpva kvqyaiw--yvsyiytsyntvkncla            
                        d q    nf  w mi da rvsmmrf-lggmqatasqylae             
                                     s      tl lh stvdlg s hpw                
                                               ig lra i  p  eh                
                                                            ae                
© 1998-2022Legal notice