Dataset for protein Bcl-xL of organism Equus caballus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2H0F6_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGTESEMETPSA
A0A3Q2H0F6_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGTESEMETPSA
                        **************************************************

A0A3Q2H0F6_BCL2L1-      INGNPSWHLADSPTGNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
A0A3Q2H0F6_BCL2L1-      INGNPSWHLADSPTGNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                        **************************************************

A0A3Q2H0F6_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A3Q2H0F6_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                        **************************************************

A0A3Q2H0F6_BCL2L1-      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWKETALGTFCYFV
A0A3Q2H0F6_BCL2L1-      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWD-----------
                        **************************************.           

A0A3Q2H0F6_BCL2L1-      SSLMRLSGQGGALQLAPSYSAFWADSRAPLGTRGFSLALQEMPLQ
A0A3Q2H0F6_BCL2L1-      -TFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                         ::: * *:..* :   . . *.    : : . *. *  . :. :

© 1998-2020Legal notice