Dataset for protein Bcl-xL of organism Equus caballus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q2H0F6_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Equus caballus GN=BCL2L1 (length=245 residues).
MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPTGNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWKETALGTFCYFVSSLMRLSGQGGALQLAPSYSAFWADSRAPLGTRGFSLALQ
EMPLQ
>gnl|bcl2dbpro|A0A3Q2H0F6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Equus caballus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPTGNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2020Legal notice