Dataset for protein Mcl-1 of organism Electrophorus electricus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W4F1X6_MCL1-01      MSMTTMKRTTAIGLLCNGAQHGVKDSFVLGVRPTMAAEDELDGC-AEDTD
A0A4W4H9I6_MCL1-01      ------------------------------------MINPQDMCYSKESS
                                                              :  * * ::::.

A0A4W4F1X6_MCL1-01      GWPLKPARHGRGLTLDTRFPQSSNADGSLPTSPDSQ-ETLPDFR----SD
A0A4W4H9I6_MCL1-01      GPGMRPV-----LSLGITSDKRVIGEGSLPNSPESDCEELSVVRFTEGRT
                        *  :.*.     *:*.    :   .:****.**:*: * *. .*      

A0A4W4F1X6_MCL1-01      LDAETRELLGYFYRTYTGLPHRRTKL-SALPTLTRVVGDVICKHRIAYNG
A0A4W4H9I6_MCL1-01      LENDTREIINDSLLELTGRSNYYSRHRKVVGTMKRVVNSLVEKHELAYKG
                        *: :***::.      ** .:  :.  ..: *:.***..:: ** :**:*

A0A4W4F1X6_MCL1-01      MVQKLQMEEQSDDLEVVSTVAKSMFSDGMTNWGRVASLVAFGAVLCESLK
A0A4W4H9I6_MCL1-01      MIVKLNLEERGEDMRVITTVAKEMFSDGKTNWGRIASLLAFGSMVCKYHN
                        *: **::**..:*: *::****.***** *****:***:***:::*:  :

A0A4W4F1X6_MCL1-01      ESGRDHCVDTVAHRISSYLTTYQHEWLLNNKSWDGFKEFFQVEDPESVVR
A0A4W4H9I6_MCL1-01      EKGQGHRVRLVGEEISSYLLSDKRDWLLKNKAWDGFVDFFHVSDPESKLR
                        *.*..* *  *.  ***** : :.:***:**:**** :**:*.**** :*

A0A4W4F1X6_MCL1-01      NALMAVAGFAGLGAGLALLMR
A0A4W4H9I6_MCL1-01      NALMTIATVAGIGAGIAFFRR
                        ****::* .**:***:*:: *

© 1998-2020Legal notice