Dataset for protein Mcl-1 of organism Electrophorus electricus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      :  * * ::::.*  :.*.     *:*.    :   .:****
------------------------------------minpqDmC-sketsGwpmrPv-----LtLgttspqsvngeGSLP
msmttmkrttaigllcngaqhgvkdsfvlgvrptmaaedel g yaedsd pglk arhgrg s dirfdkrsiad    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.**:*: * *. .*      *: :***::.      ** .:  :.  ..: *:.***..:: ** :**:**: **::**.
tSPeSq-EtLsvvR----stLeneTREllnysyrtyTGrsnyytrl-svvpTmtRVVnsvveKHrlAYnGMvvKLqmEEr
n  d dc e pdf ftegrd dad   iigdfllel  lphrrskhrkalg lk   gdlic  ei  k  iq  nl  q

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.:*: *::****.***** *****:***:***:::*:  :*.*..* *  *.  ***** : :.:***:**:**** :**
seDmrVvtTVAKsMFSDGmTNWGRvASLvAFGsvvCkylnEsGrgHrVrtVghrISSYLttyqreWLLnNKsWDGFveFF
gd le is    e     k     i   l   aml eshk k qd c dl aee     lsdkhd   k  a    kd  

       250       260       270 
....:....|....:....|....:....|.
:*.**** :*****::* .**:***:*:: *
qVsDPESvvRNALMtvAtvAGlGAGlAllrR
h e    kl     ai gf  i   i ffm 
© 1998-2020Legal notice