Dataset for protein Bcl-xL of organism Dicentrarchus labrax

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4IRU9_BCL2L1-      MSYSNRELVEFFISYKLSQRNHPTSLLRPENAGERTEGDKANSAARNGLL
E6ZFR0_BCL2L1-01        MSYSNRELVEFFISYKLSQRNHPTSLLRPENAGERTEGDKANSAARNGLL
                        **************************************************

A0A8C4IRU9_BCL2L1-      AS--------------ADIEAVKAALRDSADEFELLFTQAFSDLSSQIDI
E6ZFR0_BCL2L1-01        ASKNTSGQPGTSSSSGADIEAVKAALRDSADEFELLFTQAFSDLSSQIDI
                        **              **********************************

A0A8C4IRU9_BCL2L1-      TPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECVEKDMSELVS
E6ZFR0_BCL2L1-01        TPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECVEKDMSELVS
                        **************************************************

A0A8C4IRU9_BCL2L1-      RIADWMTMYLDEHISPWIQSQGGWDCFAEVFGRDAAAEARRSRETLSRWL
E6ZFR0_BCL2L1-01        RIADWMTMYLDEHISPWIQSQGGWDCFAEVFGRDAAAEARRSRETLSRWL
                        **************************************************

A0A8C4IRU9_BCL2L1-      LIGVALLMGAVVGVLIAKKH
E6ZFR0_BCL2L1-01        LIGVALLMGAVVGVLIAKKH
                        ********************

© 1998-2023Legal notice