Dataset for protein Bcl-xL of organism Dicentrarchus labrax

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************************************              **************
MSYSNRELVEFFISYKLSQRNHPTSLLRPENAGERTEGDKANSAARNGLLAS--------------ADIEAVKAALRDSA
                                                    kntsgqpgtssssg              

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
DEFELLFTQAFSDLSSQIDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECVEKDMSELVSRIADWMTMYL
                                                                                

       170       180       190       200       210       220
....:....|....:....|....:....|....:....|....:....|....:....|
************************************************************
DEHISPWIQSQGGWDCFAEVFGRDAAAEARRSRETLSRWLLIGVALLMGAVVGVLIAKKH
                                                            
© 1998-2023Legal notice