Dataset for protein BCL-2-like of organism Cyprinus carpio

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C1JUN1_MCL1-02      --MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVM------PEPK
A0A8C1JUN1_MCL1-01      --MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVM------PEPK
A0A8C1JXA4_BCL2L1-      ----MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTHRT----------
A0A8C1YDY0_MCL1-01      --MTLSFGIKRTAALSV---------------FAQGAHTSLVPGPALKPR
A0A8C1IQE4_BCL2-01      MAQENVYDNRSIVEKYIHHKLWKKGYVWEEDRGG----------------
X4ZGI8_BCL2-01          MANEIRYDNRNIVEKYLNHKLSKKGYEWKFQSSGEDDDTI----------
                                                                          

A0A8C1JUN1_MCL1-02      AQNEFAGN-----------------------------GLQGSVPSSPESD
A0A8C1JUN1_MCL1-01      AQNEFAGN-----------------------------GLQGSVPSSPESD
A0A8C1JXA4_BCL2L1-      --DAVEGNDDEEAA-------GTTTLVNGSLNGT-STGSTGTPPRSPTSA
A0A8C1YDY0_MCL1-01      TEDELDGYADDTEAALKPPRPGTNGLKGLQLDGRFVSAGDGSLPATPDPK
A0A8C1IQE4_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          -----------------------------------NTGVEDSSPSSDRRL
                                                                          

A0A8C1JUN1_MCL1-02      CEEIVDYSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTMKRVV
A0A8C1JUN1_MCL1-01      CEEIVDYSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTMKRVV
A0A8C1JXA4_BCL2L1-      PQ------------------------RQTNGTGGLDAVKE----ALRDSA
A0A8C1YDY0_MCL1-01      ELGSVE-------LHLDTRQLMLDFYRTHTGMCPPDRKRHHALPTMRRVV
A0A8C1IQE4_BCL2-01      -------------------TRHDPCSALHK--------------VLREAG
X4ZGI8_BCL2-01          QAPSAGGGNNSECLIANRVTRSDPYSRIYR--------------SLREAG
                                                                     :.   

A0A8C1JUN1_MCL1-02      DSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGRIAS
A0A8C1JUN1_MCL1-01      DSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGRIAS
A0A8C1JXA4_BCL2L1-      NEFELRYSQAFNDLSSQLHITPATAYQSFESVMDE-VFRD-GVNWGRIVG
A0A8C1YDY0_MCL1-01      ADILIKHQITYKGMLQRLQLDSQPDDMSFISCIAKTMFKDHTTNWGRIVS
A0A8C1IQE4_BCL2-01      DELERLYQSDFAEMSKQLHLTSITAQQRFTAVIDE-LFRD-GVNWGRIIA
X4ZGI8_BCL2-01          DQIERMYQREFEEMSHQMTFSPSAAQRSFLAVAEE-LFRD-GVNWGRIVA
                         .:   :.  :  :  .: :        *       :* *  .***** .

A0A8C1JUN1_MCL1-02      LLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDGFE
A0A8C1JUN1_MCL1-01      LLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDGFE
A0A8C1JXA4_BCL2L1-      LFAFGGALCVECVEKEMSPLVGSIAHWMTVYLDNKIQPWIQSQGGWERFA
A0A8C1YDY0_MCL1-01      LVAFGAVVCTQLKELQREQCVEAVAEQISSYLISEQHDWLLNNKSWHGFV
A0A8C1IQE4_BCL2-01      FFEFGGTVCVECVNKEMTAHVDNIAGWMTEYLNGPLHAWIQENGGWEAFV
X4ZGI8_BCL2-01          FFEFGGTMCVESFNREMASQVDNIAHWMTDYLNGPLENWIEENGGWDAFV
                        :. **. :*    :      *  :.  :: **      *: .: .*  * 

A0A8C1JUN1_MCL1-02      EFFHVPDT-------EGAVRNALMAIGSFATFGAALAYLIR---------
A0A8C1JUN1_MCL1-01      EFFHVPDT-------EGAVRNALMAIGSFATFGAALAYLIRPSVGSNEDY
A0A8C1JXA4_BCL2L1-      EIFGKDAAAESRKSQENFKKWLLAGMTLLTGVVVGSLIAQKRL-------
A0A8C1YDY0_MCL1-01      EFFRVEDV-------ESVVRSALMAVVGCAGIGAGLALLIR---------
A0A8C1IQE4_BCL2-01      ELYGRQRDSVFRSSWSSIVTVFGLAALGAVGLTIGAYLAQK---------
X4ZGI8_BCL2-01          ELYSQQRDPMFH-PLSYLTKVLGLAALGLAGVTIGAFFAQK---------
                        *::            .        .    . .  .     .         

A0A8C1JUN1_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-01      GNDTHRASPDPPAHCGSTCCGYLSQAVKLSGIQVKPCDNTCTNLHILVLW
A0A8C1JXA4_BCL2L1-      --------------------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------------------
A0A8C1IQE4_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
                                                                          

© 1998-2023Legal notice