Dataset for protein BCL-2-like of organism Cyprinus carpio

[Download (right click)] [Edit] [Sequences] [Repertoires]

27 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C1IQE4_BCL2-01      --------------------MAQENVYDNRSIVEKYIHHKLWKKGYVWE-
A0A8C2KJQ5_BCL2-02      --------------------MAQENVYDNRSIVVKYIHHKLWKKGYVWE-
A0A8C1S8K5_BCL2-01      --------------------MAQENVYDNRSIVEKYIHHKLWKKGYVWEV
A0A8C2KJQ5_BCL2-01      --------------------MAQENVYDNRSIVVKYIHHKLWKKGYVWEV
A0A8C1WYA7_BCL2-01      --------------------MANEIRYDNRNIVEKYLNHKLSKKGYEWKF
X4ZGI8_BCL2-01          --------------------MANEIRYDNRNIVEKYLNHKLSKKGYEWKF
A0A8C2G339_BCL2L1-      AIAPSLSVGRSLRRTQGCALCSKNKRVDIQTSEND-EQRQDTHRTDAAEG
A0A8C1JXA4_BCL2L1-      ---------MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTHRTDAVEG
A0A8C2HNY8_BCL2L1-      ---------MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEG
A0A8C2BAP8_MCL1-02      -----------MTLSFGIKRTAALSVFAQGAHTS-------LVPGPALKP
A0A8C2BPF9_MCL1-01      -----------MTLSFGIKRTAALSVFAQGAHTS-------LVPGPALKP
A0A8C1YDY0_MCL1-01      -----------MTLSFGIKRTAALSVFAQGAHTS-------LVPGPALKP
A0A8C2BAP8_MCL1-01      -----------MTLSFGIKRTAALSVFAQGAHTS-------LVPGPALKP
A0A8C1Y6A5_MCL1-01      -----MFPGSKVSNDNGFWPCIGITALNVSSRSS----KPQIMPEL----
A0A8C2BR28_MCL1-01      -----MFPGSKVSNDNGFWPCIGITALNVSSRSS----KPQVMPEL----
A0A8C1PPB3_MCL1-01      ---------------------MTLSLMRRTATVSLLGAHTALAPAPALKA
A0A8C1X8V5_MCL1-01      ---------------------MTLSLMRRTATVSLLGAHTALAPAPALKA
A0A8C2A7Q5_MCL1-04      --------------------------------------------------
A0A8C2KHZ4_MCL1-04      --------------------------------------------------
A0A8C2KHZ4_MCL1-01      -----MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEP----
A0A8C2A7Q5_MCL1-01      -----MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEP----
A0A8C2A7Q5_MCL1-02      -----MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEP----
A0A8C2KHZ4_MCL1-02      -----MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEP----
A0A8C1JUN1_MCL1-02      -----MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEP----
A0A8C1JUN1_MCL1-01      -----MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEP----
A0A8C2A7Q5_MCL1-03      -----MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEP----
A0A8C2KHZ4_MCL1-03      -----MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEP----
                                                                          

A0A8C1IQE4_BCL2-01      --------------------------------------EDRGGTRHDPCS
A0A8C2KJQ5_BCL2-02      --------------------------------------EDRGGTRHDPCS
A0A8C1S8K5_BCL2-01      NGHDDSVSNGLMMER----------------------QEDRGGTRHDPCS
A0A8C2KJQ5_BCL2-01      NGHDDRVSNGLMMGR----------------------QEDRGGTRHDPCS
A0A8C1WYA7_BCL2-01      QSSGEDDD-----------------------------TINTGVEDSSPSS
X4ZGI8_BCL2-01          QSSGEDDD-----------------------------TINTGVEDSSPSS
A0A8C2G339_BCL2L1-      NDDEEAAGRTTLVNGSLNGTS----------------TGSTGTPPRSPTS
A0A8C1JXA4_BCL2L1-      NDDEEAAGTTTLVNGSLNGTS----------------TGSTGTPPRSPTS
A0A8C2HNY8_BCL2L1-      NDDEEAAGTTTLVNGSLNGTS----------------TGSTGTPPRSPAS
A0A8C2BAP8_MCL1-02      RTEDELDGYADDTDAALKPPRPGTNGLKGLQLDGRFVSAGDGSLPATPDP
A0A8C2BPF9_MCL1-01      RTEDELDGYADDTDAALKPPRPGTNGLKGLQLDGRFVSAGDGSLPATPDP
A0A8C1YDY0_MCL1-01      RTEDELDGYADDTEAALKPPRPGTNGLKGLQLDGRFVSAGDGSLPATPDP
A0A8C2BAP8_MCL1-01      RTEDELDGYADDTDAALKPPRPGTNGLKGLQLDGRFVSAGDGSLPATPDP
A0A8C1Y6A5_MCL1-01      KTQNPFTR-----------------------------NGLQGSVPSSPES
A0A8C2BR28_MCL1-01      KTQNPFTR-----------------------------NGLQGSVPSLPES
A0A8C1PPB3_MCL1-01      RTEDELDGCADETDAAMKPFRPGTNGLKGLHLDGRYVSAADGSLPNTPDP
A0A8C1X8V5_MCL1-01      RTEDELDGCADETDAAMKPFRPGTNGLKGLHLDGRYVSAADGSLPNTPDP
A0A8C2A7Q5_MCL1-04      --------------------------------------------------
A0A8C2KHZ4_MCL1-04      --------------------------------------------------
A0A8C2KHZ4_MCL1-01      KAQNEFAG-----------------------------NGLQGSVPSSPES
A0A8C2A7Q5_MCL1-01      KAQNEFAG-----------------------------NGLQGSVPSSPES
A0A8C2A7Q5_MCL1-02      KAQNEFAG-----------------------------NGLQGSVPSSPES
A0A8C2KHZ4_MCL1-02      KAQNEFAG-----------------------------NGLQGSVPSSPES
A0A8C1JUN1_MCL1-02      KAQNEFAG-----------------------------NGLQGSVPSSPES
A0A8C1JUN1_MCL1-01      KAQNEFAG-----------------------------NGLQGSVPSSPES
A0A8C2A7Q5_MCL1-03      KAQNEFAG-----------------------------NGLQGSVPSSPES
A0A8C2KHZ4_MCL1-03      KAQNEFAG-----------------------------NGLQGSVPSSPES
                                                                          

A0A8C1IQE4_BCL2-01      A--------------------------------------------LHKVL
A0A8C2KJQ5_BCL2-02      A--------------------------------------------LHKVL
A0A8C1S8K5_BCL2-01      A--------------------------------------------LHTVL
A0A8C2KJQ5_BCL2-01      A--------------------------------------------LHKVL
A0A8C1WYA7_BCL2-01      DRRLQAPSAGGGNNSECLIANRVTRSDPYSRIY--------------RSL
X4ZGI8_BCL2-01          DRRLQAPSAGGGNNSECLIANRVTRSDPYSRIY--------------RSL
A0A8C2G339_BCL2L1-      APQRQTN-------------------------------GTGGLDAVKEAL
A0A8C1JXA4_BCL2L1-      APQRQTN-------------------------------GTGGLDAVKEAL
A0A8C2HNY8_BCL2L1-      TPQRQTN-------------------------------GTGGLDAVKEAL
A0A8C2BAP8_MCL1-02      KELGSVE----------LHLDTRQLMLDFYRTHTGMCPPDRKRHHALPTM
A0A8C2BPF9_MCL1-01      KELGSVE----------LHLDTRQLMLDFYRTHTGMCPLDRKRHHALPTM
A0A8C1YDY0_MCL1-01      KELGSVE----------LHLDTRQLMLDFYRTHTGMCPPDRKRHHALPTM
A0A8C2BAP8_MCL1-01      KELGSVE----------LHLDTRQLMLDFYRTHTGMCPPDRKRHHALPTM
A0A8C1Y6A5_MCL1-01      DCEKTPDEYTSNRIYDALEMDTREIIDIFLKNFNGLPHSKRGNKQVLETM
A0A8C2BR28_MCL1-01      DCEKTPDEYTSNRIYDALEMDTREIIDIFLKNFTGLPHSKRGNKQVLETM
A0A8C1PPB3_MCL1-01      Q----------EFGSAELGRDTRRLLLDFYRTHTGLCPRDRKQHHALPTM
A0A8C1X8V5_MCL1-01      Q----------EFGSAELGRDTRRLLLDFYRTHTGLCPRDRKQHHALPTM
A0A8C2A7Q5_MCL1-04      ---------------------------------MSLAFSRAPRKTAGNRM
A0A8C2KHZ4_MCL1-04      ---------------------------------MSLAFSRAPRKTAGNRM
A0A8C2KHZ4_MCL1-01      DCEETVD---YSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTM
A0A8C2A7Q5_MCL1-01      DCEEIVD---YSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTM
A0A8C2A7Q5_MCL1-02      DCEEIVD---YSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTM
A0A8C2KHZ4_MCL1-02      DCEETVD---YSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTM
A0A8C1JUN1_MCL1-02      DCEEIVD---YSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTM
A0A8C1JUN1_MCL1-01      DCEEIVD---YSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTM
A0A8C2A7Q5_MCL1-03      DCEEIVD---YSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTM
A0A8C2KHZ4_MCL1-03      DCEETVD---YSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTM
                                                                         :

A0A8C1IQE4_BCL2-01      REAGDELERLYQSDFAEMSKQLHLTSITAQQRF-TAVIDELFRDGV-NWG
A0A8C2KJQ5_BCL2-02      REAGDELERLYQSDFAEMSKQLHLTSITAQQRF-TAVIDELFRDGV-NWG
A0A8C1S8K5_BCL2-01      REAGDELERLYQSDFAEMSKQLHITSITAQQRF-TAVIDELFRDGV-NWG
A0A8C2KJQ5_BCL2-01      REAGDELERLYQSDFAEMSKQLHLTSITAQQRF-TAVIDELFRDGV-NWG
A0A8C1WYA7_BCL2-01      REAGDQIERMYQREFEEMSHQMTFSPSAAQRSFL-AVAEELFRDGV-NWG
X4ZGI8_BCL2-01          REAGDQIERMYQREFEEMSHQMTFSPSAAQRSFL-AVAEELFRDGV-NWG
A0A8C2G339_BCL2L1-      RDSANEFELRYSQAFNDLSSQLHITPATAYQSF-ESVMDEVFRDGV-NWG
A0A8C1JXA4_BCL2L1-      RDSANEFELRYSQAFNDLSSQLHITPATAYQSF-ESVMDEVFRDGV-NWG
A0A8C2HNY8_BCL2L1-      RDSANEFELRYSQAFNDLSLQLHITPATAYQSF-ESVMDEVFRDGV-NWG
A0A8C2BAP8_MCL1-02      RRVVADILIKHQITYKGMLQRLQLDSQPDDMSFISCIAKTMFKDHTTNWG
A0A8C2BPF9_MCL1-01      RRVVADILIKHQITYKGMLQRLQLDSEPDDMSFISCIAKTMFKDHTTNWG
A0A8C1YDY0_MCL1-01      RRVVADILIKHQITYKGMLQRLQLDSQPDDMSFISCIAKTMFKDHTTNWG
A0A8C2BAP8_MCL1-01      RRVVADILIKHQITYKGMLQRLQLDSQPDDMSFISCIAKTMFKDHTTNWG
A0A8C1Y6A5_MCL1-01      NRVVESLVVKHELAYKGMIARLNLEQKGEDVSFVKTVATELFSDGITNWG
A0A8C2BR28_MCL1-01      NRVVESLVVKHELAYKGMIARLNLEQKGEDVSFVKTVATELFSDGISNWG
A0A8C1PPB3_MCL1-01      TRVVADILLKHEIAYKGMLQRLQLDSQPDDMSFISCIAKTMFKDHTTNWG
A0A8C1X8V5_MCL1-01      TRVVADILLKHEIAYKGMLQRLQLDSQPDDMSFISCIAKTMFKDHTTNWG
A0A8C2A7Q5_MCL1-04      SRLLDA---------------------EEEDEFYKT--------------
A0A8C2KHZ4_MCL1-04      SRLLDA---------------------EEEDEFYKT--------------
A0A8C2KHZ4_MCL1-01      KRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWG
A0A8C2A7Q5_MCL1-01      KRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWG
A0A8C2A7Q5_MCL1-02      KRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWG
A0A8C2KHZ4_MCL1-02      KRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWG
A0A8C1JUN1_MCL1-02      KRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWG
A0A8C1JUN1_MCL1-01      KRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWG
A0A8C2A7Q5_MCL1-03      KRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWG
A0A8C2KHZ4_MCL1-03      KRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWG
                                                        *                 

A0A8C1IQE4_BCL2-01      RIIAFFEFGGTVCVECVNKEMTAHVDNIAGWMTEYLNGPLHAWIQENGGW
A0A8C2KJQ5_BCL2-02      RIIAFFEFGGTVCVECVNKEMTAHVDNIAGWMTEYLNGPLHAWIQENGGW
A0A8C1S8K5_BCL2-01      RIIAFFEFGGTVCVECVNKEMTAHVDNIAGWMTEYLNGPLHAWIQENGGW
A0A8C2KJQ5_BCL2-01      RIIAFFEFGGTVCVECVNKEMTAHVDNIAGWMTEYLNGPLHAWIQENGGW
A0A8C1WYA7_BCL2-01      RIVAFFEFGGTMCVESFNREMASQVDNIAHWMTDYLNGPLENWIEENGGW
X4ZGI8_BCL2-01          RIVAFFEFGGTMCVESFNREMASQVDNIAHWMTDYLNGPLENWIEENGGW
A0A8C2G339_BCL2L1-      RIVGLFAFGGALCVECVEKEMSPLVGSIADWMTVYLDNKIQPWIQSQGGW
A0A8C1JXA4_BCL2L1-      RIVGLFAFGGALCVECVEKEMSPLVGSIAHWMTVYLDNKIQPWIQSQGGW
A0A8C2HNY8_BCL2L1-      RIVGLFAFGGALCVECVEKEMSPLVGSIAEWMIVYLDNKIQPWIQSQGGW
A0A8C2BAP8_MCL1-02      RIVSLVAFGAVVCTQLKELQRERCVEAVAEQISSYLISEQHDWLLNNKSW
A0A8C2BPF9_MCL1-01      RIVSLVAFGAVVCTQLKELQRERCVEAVAEQISSYLISEQHDWLLNNKSW
A0A8C1YDY0_MCL1-01      RIVSLVAFGAVVCTQLKELQREQCVEAVAEQISSYLISEQHDWLLNNKSW
A0A8C2BAP8_MCL1-01      RIVSLVAFGAVVCTQLKELQRERCVEAVAEQISSYLISEQHDWLLNNKSW
A0A8C1Y6A5_MCL1-01      RIASLLTFGAMVCKHQKDKGLTNCVSLVGKEISNYLLTAQRDWLLKNKAW
A0A8C2BR28_MCL1-01      RIASLLTFGAMVCKHQKDKGLSNCVSLVGKEISNYLLTAQRDWLLKNKAW
A0A8C1PPB3_MCL1-01      RIVSLVAFGAVVCTHLKELQRERCVETVAEQISSYLISEQHDWLLNNKSW
A0A8C1X8V5_MCL1-01      RIVSLVAFGAVVCTQLKELQRERCVEAVAEQISSYLISEQHDWLLNNKSW
A0A8C2A7Q5_MCL1-04      ------------------------------------------------TY
A0A8C2KHZ4_MCL1-04      ------------------------------------------------TY
A0A8C2KHZ4_MCL1-01      RIASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAW
A0A8C2A7Q5_MCL1-01      RIASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAW
A0A8C2A7Q5_MCL1-02      RIASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAW
A0A8C2KHZ4_MCL1-02      RIASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAW
A0A8C1JUN1_MCL1-02      RIASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAW
A0A8C1JUN1_MCL1-01      RIASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAW
A0A8C2A7Q5_MCL1-03      RIASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAW
A0A8C2KHZ4_MCL1-03      RIASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAW
                                                                         :

A0A8C1IQE4_BCL2-01      EA-----------------FVELYGRQRDSVFRSSWSSIVTVFGLAALGA
A0A8C2KJQ5_BCL2-02      EA-----------------FVELYGRQRDSVFRSSWSSIVTVFGLAALGA
A0A8C1S8K5_BCL2-01      EA-----------------FVELYGRQRDSVFRSSWSSIVTVFGLAALGA
A0A8C2KJQ5_BCL2-01      EA-----------------FVELYGRQRDSVFRSSWSSIVTVFGLAALGA
A0A8C1WYA7_BCL2-01      DA-----------------FVELYS-QQRDSMFHPLSYLTKVLGLAALGL
X4ZGI8_BCL2-01          DA-----------------FVELYS-QQRDPMFHPLSYLTKVLGLAALGL
A0A8C2G339_BCL2L1-      ER-----------------FAEIFGKDAAAESRKSQENFKKWLLAGMTLL
A0A8C1JXA4_BCL2L1-      ER-----------------FAEIFGKDAAAESRKSQENFKKWLLAGMTLL
A0A8C2HNY8_BCL2L1-      ER-----------------FAEIFGKDAAAESRKSQENFRKWLLAGITLL
A0A8C2BAP8_MCL1-02      VSDHTLVFPSLRNSEPFCVCVESSPFNTRETCIRPP-----EKPLLNSPT
A0A8C2BPF9_MCL1-01      HG-----------------FVEFFRVEDVESVVRSA-----LMAVVGCAG
A0A8C1YDY0_MCL1-01      HG-----------------FVEFFRVEDVESVVRSA-----LMAVVGCAG
A0A8C2BAP8_MCL1-01      HG-----------------FVEFFRVEDVESVVRSA-----LMAVVGCAG
A0A8C1Y6A5_MCL1-01      DG-----------------FVEFFRVPDTEGAVRNA-----LMAIGSVAT
A0A8C2BR28_MCL1-01      DG-----------------FVEFFRVPDTEGAVRNA-----LMAIGSVAT
A0A8C1PPB3_MCL1-01      HG-----------------FVEFFRVEDVESVVRNA-----LMAVVGCAG
A0A8C1X8V5_MCL1-01      HG-----------------FVEFFRVEDVESVVRNA-----LMAVVGCAG
A0A8C2A7Q5_MCL1-04      GG-----------------FHD----------------------------
A0A8C2KHZ4_MCL1-04      GG-----------------FHD----------------------------
A0A8C2KHZ4_MCL1-01      DG-----------------FEEFFHVPDTEGAVRNA-----LMAIGSFAT
A0A8C2A7Q5_MCL1-01      DG-----------------FEEFFHVPDTEGAVRNA-----LMAIGSFAT
A0A8C2A7Q5_MCL1-02      DG-----------------FEEFFHVPDTEGAVRNA-----LMAIGSFAT
A0A8C2KHZ4_MCL1-02      DG-----------------FEEFFHVPDTEGAVRNA-----LMAIGSFAT
A0A8C1JUN1_MCL1-02      DG-----------------FEEFFHVPDTEGAVRNA-----LMAIGSFAT
A0A8C1JUN1_MCL1-01      DG-----------------FEEFFHVPDTEGAVRNA-----LMAIGSFAT
A0A8C2A7Q5_MCL1-03      DG-----------------FEEFFHVPDTEGAVRNA-----LMAIGSFAT
A0A8C2KHZ4_MCL1-03      DG-----------------FEEFFHVPDTEGAVRNA-----LMAIGSFAT
                                             :                            

A0A8C1IQE4_BCL2-01      VGLTIGAYLAQK--------------------------------------
A0A8C2KJQ5_BCL2-02      VGLTIGAYLAQK--------------------------------------
A0A8C1S8K5_BCL2-01      VGLTIGAYLAQK--------------------------------------
A0A8C2KJQ5_BCL2-01      VGLTIGAYLAQK--------------------------------------
A0A8C1WYA7_BCL2-01      AGVTIGAFFAQK--------------------------------------
X4ZGI8_BCL2-01          AGVTIGAFFAQK--------------------------------------
A0A8C2G339_BCL2L1-      TGVVVGSLIAQKRL------------------------------------
A0A8C1JXA4_BCL2L1-      TGVVVGSLIAQKRL------------------------------------
A0A8C2HNY8_BCL2L1-      TGVVVGSLIAQKRL------------------------------------
A0A8C2BAP8_MCL1-02      SSSAP---------------------------------------------
A0A8C2BPF9_MCL1-01      IGAGLALLIR----------------------------------------
A0A8C1YDY0_MCL1-01      IGAGLALLIR----------------------------------------
A0A8C2BAP8_MCL1-01      IGAGLALLIR----------------------------------------
A0A8C1Y6A5_MCL1-01      FGAALAYLIR----------------------------------------
A0A8C2BR28_MCL1-01      FGAALAYLIR----------------------------------------
A0A8C1PPB3_MCL1-01      IGAGLAFLIR----------------------------------------
A0A8C1X8V5_MCL1-01      IGAGLAFLIR----------------------------------------
A0A8C2A7Q5_MCL1-04      --------------------------------------------------
A0A8C2KHZ4_MCL1-04      --------------------------------------------------
A0A8C2KHZ4_MCL1-01      FGAALAYLIRPSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSG
A0A8C2A7Q5_MCL1-01      FGAALAYLIRPSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSG
A0A8C2A7Q5_MCL1-02      FGAALAYLIRPSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSG
A0A8C2KHZ4_MCL1-02      FGAALAYLIRPSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSG
A0A8C1JUN1_MCL1-02      FGAALAYLIR----------------------------------------
A0A8C1JUN1_MCL1-01      FGAALAYLIRPSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSG
A0A8C2A7Q5_MCL1-03      FGAALAYLIRPSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSG
A0A8C2KHZ4_MCL1-03      FGAALAYLIRPSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSG
                                                                          

A0A8C1IQE4_BCL2-01      --------------------------------------------------
A0A8C2KJQ5_BCL2-02      --------------------------------------------------
A0A8C1S8K5_BCL2-01      --------------------------------------------------
A0A8C2KJQ5_BCL2-01      --------------------------------------------------
A0A8C1WYA7_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
A0A8C2G339_BCL2L1-      --------------------------------------------------
A0A8C1JXA4_BCL2L1-      --------------------------------------------------
A0A8C2HNY8_BCL2L1-      --------------------------------------------------
A0A8C2BAP8_MCL1-02      --------------------------------------------------
A0A8C2BPF9_MCL1-01      --------------------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------------------
A0A8C2BAP8_MCL1-01      --------------------------------------------------
A0A8C1Y6A5_MCL1-01      --------------------------------------------------
A0A8C2BR28_MCL1-01      --------------------------------------------------
A0A8C1PPB3_MCL1-01      --------------------------------------------------
A0A8C1X8V5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-04      --ESGDEEYKGDLSETEDEVDSDFDIDEGDEPDSEQEEDGPRRKSRVVTK
A0A8C2KHZ4_MCL1-04      --ESGDEEYKGDLSETEDEVDSDFDIDEGDEPDSEQEEDGPRRKSRVVTK
A0A8C2KHZ4_MCL1-01      IQESGDEEYKGDLSETEDEVDSDFDIDEGDEPDSEQEEDGPRRKSRVVTK
A0A8C2A7Q5_MCL1-01      IQESGDEEYKGDLSETEDEVDSDFDIDEGDEPDSEQEEDGPRRKSRVVTK
A0A8C2A7Q5_MCL1-02      IQGLISE----------------------PSPQESVSFSVTALEKMVCMH
A0A8C2KHZ4_MCL1-02      IQGLISE----------------------PSPQESVSFSVTALEKMVCMH
A0A8C1JUN1_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-01      IQVKPCD----------------------NTC-----------TNLHILV
A0A8C2A7Q5_MCL1-03      IQEKRSH----------------------DVS-----------ER-----
A0A8C2KHZ4_MCL1-03      IQEKRSH----------------------DVS-----------ER-----
                                                                          

A0A8C1IQE4_BCL2-01      --------------------------------------------------
A0A8C2KJQ5_BCL2-02      --------------------------------------------------
A0A8C1S8K5_BCL2-01      --------------------------------------------------
A0A8C2KJQ5_BCL2-01      --------------------------------------------------
A0A8C1WYA7_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
A0A8C2G339_BCL2L1-      --------------------------------------------------
A0A8C1JXA4_BCL2L1-      --------------------------------------------------
A0A8C2HNY8_BCL2L1-      --------------------------------------------------
A0A8C2BAP8_MCL1-02      --------------------------------------------------
A0A8C2BPF9_MCL1-01      --------------------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------------------
A0A8C2BAP8_MCL1-01      --------------------------------------------------
A0A8C1Y6A5_MCL1-01      --------------------------------------------------
A0A8C2BR28_MCL1-01      --------------------------------------------------
A0A8C1PPB3_MCL1-01      --------------------------------------------------
A0A8C1X8V5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-04      AYKEPVKVVRQKPKQRKLAELPRRTVKTKINKYNPPELQEDINKNRKSVR
A0A8C2KHZ4_MCL1-04      AYKEPVKVVRQKPKQRKLAELPRRTVKTKINKYNPPELQEDINKNRKSVR
A0A8C2KHZ4_MCL1-01      AYKEPVKVVRQKPKQRKLAELPRRTVKTKINKYNPPELQEDINKNRKSVR
A0A8C2A7Q5_MCL1-01      AYKEPVKVVRQKPKQRKLAELPRRTVKTKINKYNPPELQEDINKSETFAL
A0A8C2A7Q5_MCL1-02      FWTSRHANVQNNDHGMLLAFLINTVAYLNFFRVSLFFLFC--FLTKCYAQ
A0A8C2KHZ4_MCL1-02      FWTSRHANVQNNDHGMLLAFLINTVGYLNFFRVSLFFFFCFFFLTKCYAQ
A0A8C1JUN1_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-01      LW------------------------------------------------
A0A8C2A7Q5_MCL1-03      -WAGHLRHHVRQNRSKHKFGL-----------------------------
A0A8C2KHZ4_MCL1-03      -WAGHLRHHVRQNRSKHKFGL-----------------------------
                                                                          

A0A8C1IQE4_BCL2-01      --------------------------------------------------
A0A8C2KJQ5_BCL2-02      --------------------------------------------------
A0A8C1S8K5_BCL2-01      --------------------------------------------------
A0A8C2KJQ5_BCL2-01      --------------------------------------------------
A0A8C1WYA7_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
A0A8C2G339_BCL2L1-      --------------------------------------------------
A0A8C1JXA4_BCL2L1-      --------------------------------------------------
A0A8C2HNY8_BCL2L1-      --------------------------------------------------
A0A8C2BAP8_MCL1-02      --------------------------------------------------
A0A8C2BPF9_MCL1-01      --------------------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------------------
A0A8C2BAP8_MCL1-01      --------------------------------------------------
A0A8C1Y6A5_MCL1-01      --------------------------------------------------
A0A8C2BR28_MCL1-01      --------------------------------------------------
A0A8C1PPB3_MCL1-01      --------------------------------------------------
A0A8C1X8V5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-04      QSTTEHTRLTYLRLQERQVAPRRRKGTRHERPLTQAELLAEAKVTAQINL
A0A8C2KHZ4_MCL1-04      QSTTEHTRLTYLRLQERQVAPRRRKGTRHERPLTQAELLAEAKVTAQINL
A0A8C2KHZ4_MCL1-01      QSTTEHTRLTYLRLQERQVAPRRRKGTRHERPLTQAELLAEAKVTAQINL
A0A8C2A7Q5_MCL1-01      YLHMHM--------------------------------------------
A0A8C2A7Q5_MCL1-02      MSLPGIKMIIKLMIFSKNI-------------------------------
A0A8C2KHZ4_MCL1-02      MSLPVIKMIIKLMIFSKNIYE-----------------------------
A0A8C1JUN1_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-03      --------------------------------------------------
A0A8C2KHZ4_MCL1-03      --------------------------------------------------
                                                                          

A0A8C1IQE4_BCL2-01      --------------------------------------------------
A0A8C2KJQ5_BCL2-02      --------------------------------------------------
A0A8C1S8K5_BCL2-01      --------------------------------------------------
A0A8C2KJQ5_BCL2-01      --------------------------------------------------
A0A8C1WYA7_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
A0A8C2G339_BCL2L1-      --------------------------------------------------
A0A8C1JXA4_BCL2L1-      --------------------------------------------------
A0A8C2HNY8_BCL2L1-      --------------------------------------------------
A0A8C2BAP8_MCL1-02      --------------------------------------------------
A0A8C2BPF9_MCL1-01      --------------------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------------------
A0A8C2BAP8_MCL1-01      --------------------------------------------------
A0A8C1Y6A5_MCL1-01      --------------------------------------------------
A0A8C2BR28_MCL1-01      --------------------------------------------------
A0A8C1PPB3_MCL1-01      --------------------------------------------------
A0A8C1X8V5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-04      RSLENYERLEADKKRQVHMKRQCVGSVIRYHSVLMPLVSDVTLKEENVDV
A0A8C2KHZ4_MCL1-04      RSLENYERLEADKKRQVHMKRQCVGSVIRYHSVLMPLVSDVTLKEENVDV
A0A8C2KHZ4_MCL1-01      RSLENYERLEADKKRQVHMKRQCVGSVIRYHSVLMPLVSDVTLKEENVDV
A0A8C2A7Q5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-02      --------------------------------------------------
A0A8C2KHZ4_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-03      --------------------------------------------------
A0A8C2KHZ4_MCL1-03      --------------------------------------------------
                                                                          

A0A8C1IQE4_BCL2-01      --------------------------------------------------
A0A8C2KJQ5_BCL2-02      --------------------------------------------------
A0A8C1S8K5_BCL2-01      --------------------------------------------------
A0A8C2KJQ5_BCL2-01      --------------------------------------------------
A0A8C1WYA7_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
A0A8C2G339_BCL2L1-      --------------------------------------------------
A0A8C1JXA4_BCL2L1-      --------------------------------------------------
A0A8C2HNY8_BCL2L1-      --------------------------------------------------
A0A8C2BAP8_MCL1-02      --------------------------------------------------
A0A8C2BPF9_MCL1-01      --------------------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------------------
A0A8C2BAP8_MCL1-01      --------------------------------------------------
A0A8C1Y6A5_MCL1-01      --------------------------------------------------
A0A8C2BR28_MCL1-01      --------------------------------------------------
A0A8C1PPB3_MCL1-01      --------------------------------------------------
A0A8C1X8V5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-04      EGLDQDAQQNPGPHPSQALSQSESTLTAPPSVFSSNTAAVNPSLSSGPAK
A0A8C2KHZ4_MCL1-04      EGLDQDAQQNPGPHPSQALSQSESTLTAPPSVFSSNTAAVNPSLSSGPAK
A0A8C2KHZ4_MCL1-01      EGLDQDAQQNPGPHPSQALSQSESTLTAPPSVFSSNTAAVNPSLSSGPAK
A0A8C2A7Q5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-02      --------------------------------------------------
A0A8C2KHZ4_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-03      --------------------------------------------------
A0A8C2KHZ4_MCL1-03      --------------------------------------------------
                                                                          

A0A8C1IQE4_BCL2-01      --------------------------------------------------
A0A8C2KJQ5_BCL2-02      --------------------------------------------------
A0A8C1S8K5_BCL2-01      --------------------------------------------------
A0A8C2KJQ5_BCL2-01      --------------------------------------------------
A0A8C1WYA7_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
A0A8C2G339_BCL2L1-      --------------------------------------------------
A0A8C1JXA4_BCL2L1-      --------------------------------------------------
A0A8C2HNY8_BCL2L1-      --------------------------------------------------
A0A8C2BAP8_MCL1-02      --------------------------------------------------
A0A8C2BPF9_MCL1-01      --------------------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------------------
A0A8C2BAP8_MCL1-01      --------------------------------------------------
A0A8C1Y6A5_MCL1-01      --------------------------------------------------
A0A8C2BR28_MCL1-01      --------------------------------------------------
A0A8C1PPB3_MCL1-01      --------------------------------------------------
A0A8C1X8V5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-04      CSRTYITFSDDESLQRFFPQSPPPRIPVQEICPVTHKPALYRDPITDIPY
A0A8C2KHZ4_MCL1-04      CSRTYITFSDDESLQRFFPQSPPPRIPVQEICPVTHKPALYRDPITDIPY
A0A8C2KHZ4_MCL1-01      CSRTYITFSDDESLQRFFPQSPPPRIPVQEICPVTHKPALYRDPITDIPY
A0A8C2A7Q5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-02      --------------------------------------------------
A0A8C2KHZ4_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-03      --------------------------------------------------
A0A8C2KHZ4_MCL1-03      --------------------------------------------------
                                                                          

A0A8C1IQE4_BCL2-01      ------------------------------------------------
A0A8C2KJQ5_BCL2-02      ------------------------------------------------
A0A8C1S8K5_BCL2-01      ------------------------------------------------
A0A8C2KJQ5_BCL2-01      ------------------------------------------------
A0A8C1WYA7_BCL2-01      ------------------------------------------------
X4ZGI8_BCL2-01          ------------------------------------------------
A0A8C2G339_BCL2L1-      ------------------------------------------------
A0A8C1JXA4_BCL2L1-      ------------------------------------------------
A0A8C2HNY8_BCL2L1-      ------------------------------------------------
A0A8C2BAP8_MCL1-02      ------------------------------------------------
A0A8C2BPF9_MCL1-01      ------------------------------------------------
A0A8C1YDY0_MCL1-01      ------------------------------------------------
A0A8C2BAP8_MCL1-01      ------------------------------------------------
A0A8C1Y6A5_MCL1-01      ------------------------------------------------
A0A8C2BR28_MCL1-01      ------------------------------------------------
A0A8C1PPB3_MCL1-01      ------------------------------------------------
A0A8C1X8V5_MCL1-01      ------------------------------------------------
A0A8C2A7Q5_MCL1-04      ANVQAFRIIREAYKKYVAAHGLPSTGTVTPADTTAKNLRQKIIIKQGM
A0A8C2KHZ4_MCL1-04      ANVQAFRIIREAYKKYVAAHGLPSTGTATPADTTAKNLRQKIIIKQGM
A0A8C2KHZ4_MCL1-01      ANVQAFRIIREAYKKYVAAHGLPSTGTATPADTTAKNLRQKIIIKQGM
A0A8C2A7Q5_MCL1-01      ------------------------------------------------
A0A8C2A7Q5_MCL1-02      ------------------------------------------------
A0A8C2KHZ4_MCL1-02      ------------------------------------------------
A0A8C1JUN1_MCL1-02      ------------------------------------------------
A0A8C1JUN1_MCL1-01      ------------------------------------------------
A0A8C2A7Q5_MCL1-03      ------------------------------------------------
A0A8C2KHZ4_MCL1-03      ------------------------------------------------
                                                                        

© 1998-2022Legal notice