Dataset for protein BCL-2-like of organism Cyprinus carpio

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--mfpsyknrnivglypciklsklnynwsssgfgrkplvm-------------e--gn----------------------
ma-engsdvssdnekwi-hgiaakgv-n----sted-ht-lvpgpapepkaqn-fa--ddeteaalkpprpgtttlvnls
  q-mvfyikrtavfsvn--------v-nhqsga--t--t      lk rtedave ya dea          ng kggq
  ntlr g  el a flky  wqr  pykfir  qgddrs              ld                        
    i            h        e eede    a  i                                        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                 :.    .:   :.  
-------glqgsvpsspesdce--v--------l--dtrtridpfsrshtg-------k-----tmrrvvdslevkyqla
lngtfvt---------------es-dyspvcaa-em---ei--i-lktfr-lphsksg-kqilsvlkeagneivrrhest
 d r ssavtdts rtdtrlqqpiagggnnsec ilnrv--sl-y-aqyn tgppdrvrhha ps  dsaaqfllm sre
     n  se  p a  rpkplg  e        ha   qlm dcy ltk mcgl ak e    a      d  il  qd
        gd  l    d aea                   h     i                              

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:  :  .: :        *       :* *  .***** .:. **. :*    :      *  :.  :: **      *:
ykgmsarlnltsktadvsFvsvvae-lFrD-gvNWGRIvslftFGgtvCveqvnremskcVsnvaewmtsYLntpqrhWl
fnelisqmhiepsgeqqr tktidtev s git     aafle  aim khcnekgltsq dligheisv  lgdlhp i
 ed lq  tfseqpdyr  lacmektm k ht      ig va   vl tqskdlqreql gs  gq  e  iskiqn  
   k  q d ia  m  i  a                       a    lf    aph ea      d  dne ed  
     h      a      e                                      a                  a  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .: .*  * *::            .        .    . .  .     .                             
lknkgWdgFvEffhvqdt-------esavrvalmailglagvgaglaylqr-----------------------------
qeqga ea e lygrprdsvfrsswsgvtknlglgagsfvtftiaaylaikrsvgsnedygndthraspdppahcgstcc
es  s hr a sqeavpmshkpq ylktwf a vvlct lvv sli   pl                           
 n           rkd aae    l ni  s    mt a  i    ff                                
                           f                                                    

       330       340       350
....:....|....:....|....:....|
                              
------------------------------
gylsqavklsgiqvkpcdntctnlhilvlw
                              
                              
                              
© 1998-2023Legal notice