Dataset for protein BCL-2-like of organism Cyprinus carpio

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------n--g---cigiaalnvnnsss--g-kplvmpgp----ktqnefag----------------------
aiapsmfpgskvs-dn-lwpmaqlsvydnrsivegf-rh--lkkeyawkpraed-ld-yaddtdaalkpprpgtnglkgl
     lsv msmtlsflikr--aenlfargahtnkyih-kdwvrtdvlegn---p--stttlvngsmngts         
         r yyrre vvftmk-kr--q-----llenttqt----ea v-ddedavrnglmmer    f          
           lr tq falfs-y--sr-tytyvhilfrea-h al v fqssg dtdc  e g                
                 c    tnt mqistre d  a q sa      a gh  s  r                     
                      n i v  q p     q   in            r                        
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                     :          
-------nglqGsvpssPesdce--vd----------lemdtreiidiflk-ftglphsksgkkqilstmrrvvdslvvk
qldgrfvsagd-glrht-dpa--et--sytyspvcaa--------------s--------r----ahpvlkeagaeierl
h    y tedt tt-ad c-kelgqteeagsnrnsee hlnrvqlmldyyrthmsmcppd-krhhvkea tdsandfllr
       --sr -pdr- - -pqripn   ggniydc ir   trs p s nyn  afgtgpldal-ks s lleq--i-
       qi-- v- -l t qrrlsap    efg    ga   r l     i      rra q t-grr n    a  -m
         n   e n  s t  k                                  l   n    n            
         a        a                                                t            
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                      *                                                         
helaykgmiarlnleskgedvsFvktvatelFsDgitNWGRIvslltFGaivCkhqndrglskcVslvaeeissYLltdq
yqitfaelsqq-hiteqtaqqr -sciidtm-r-hv------aaffa--gvl-veckekemerh-eniggwmte--nspl
-ssd-nd-lk-mq-dpipdyme ita-mk-v k -ts     ig-ve  -t- tqlvnlqrtal da--hq--v  igei
 -q- -- --  -f--ae er  yes -- - -  -      -- --   am ---------p- gs  -- i-  dnk-
  -e e   s  t sq-a  d  l-   e                     -    sf    a-q --  k   n  --- 
  r      h      s                                 m           s   t  d   d    a 
         l      e                                             n                 
                                                              q                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         :                     :                                                
rhWllknkaWdg-----------------FvEffhvpdtegavrna-----lmaigsfatfgaalaylir----------
hd-iqnqggyeadhtlvfpslrnsepfcvcedlyr-qrvssvrsswssivkvlglaalgli-vtigaylaqkvgsnedyg
qa --e--s hr                  a i-greadavf-kpqenfttwflvvgclgvslgv-----psrl      
-p  es  t gs                  h -s-kd-r-esf--- ylk ---a--t-at -v- sff           
e-   -    v                     s sf-qad--ih l   r ekp-lm-p-- s-p l             
 n                                p nt- tm   p          nv  a     f             
                                        pc              is  s                   
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ndthraspdppahcgstccgylsqavklsgiqesgseeykgdlsetedevdsdfdidegdepdseqeedgprrksrvvtk
                                gkrdh                      pvsqesvsfsvtalermhcmh
                                vlicd                      nsc           tkl ilv
                                  p                         t             n     
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
awkepvkvvrqkpkqrklaelprrtvktkinkynppelqedinknrksvrqsttehtrltylrlqerqvaprrrkgtrhe
fytsrlrnhvrqnrsmlkfg intvgylnffrvslffffcfffltkcyaqmllpvikmiik mifskniye         
l aghhah qnndhgkh  f     a                  setf ly hmhm                        
                                                      g                         
                                                                                
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
rpltqaellaeakvtaqinlrslenyerleadkkrqvhmkrqcvgsviryhsvlmplvsdvtlkeenvdvegldqdaqqn
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pgphpsqalsqsestltappsvfssntaavnpslssgpakcsrtyitfsddeslqrffpqspppripvqeicpvthkpal
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       650       660       670       680       690        
....:....|....:....|....:....|....:....|....:....|....:...
                                                          
----------------------------------------------------------
yrdpitdipyanvqafriireaykkyvaahglpstgtatpadttaknlrqkiiikqgm
                                     v                    
                                                          
                                                          
                                                          
                                                          
                                                          
© 1998-2022Legal notice