Dataset for protein BCL-2-like of organism Colobus angolensis palliatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5HK49_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDV---------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSD---------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG---------------
A0A2K5I9I0_MCL1-03      ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLL-----
A0A2K5I9I0_MCL1-01      ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKE
A0A2K5I9I0_MCL1-02      ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKE
A0A2K5HEJ9_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG---------------
A0A2K5HEJ9_BCL2L2-      ---MEEEAEKLKELQNEVEKQMNM----SPPPGNA---------------
A0A2K5KAA3_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQ----IPQPGSG---------------
A0A2K5KAA3_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQ----IPQPGSG---------------
                                                                          

A0A2K5HK49_BCL2-01      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-01      ASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTA
A0A2K5I9I0_MCL1-02      ASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTA
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5HK49_BCL2-01      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-01      TPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
A0A2K5I9I0_MCL1-02      TPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5HK49_BCL2-01      -------GAATPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLPTPAAP
A0A2K5H963_BCL2L1-      ------------------------------------MWKRTGLRPQKG--
A0A2K5H963_BCL2L1-      -------VEENRTEAPEG---TESEMETPSAINGNPSWHLVDSPAVNGAT
A0A2K5K3B0_BCL2L10      ----------------------MADQLRERTNVADPLRERTERLLADYLG
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5I9I0_MCL1-03      -----------------------------------------------ATG
A0A2K5I9I0_MCL1-01      PLLELVGESNSSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATG
A0A2K5I9I0_MCL1-02      PLLELVGESNSSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATG
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5HK49_BCL2-01      AAAAGPALSPVPPV--VHLTLRQAG-------------DDFSRRYRRDFA
A0A2K5H963_BCL2L1-      ----------------------------------------LNRRWRPPVP
A0A2K5H963_BCL2L1-      GHSSSLDAREVIPMAAVKQALREAG-------------DEFELRYRRAFS
A0A2K5K3B0_BCL2L10      CCAREPGTPEPRPSTPEAAVLRSAA-------------ARLRQLHRSFFS
A0A2K5HEJ9_BCL2L2-      ---------EGPAADPLHQAMRAAG-------------DEFETRFRRTFS
A0A2K5I9I0_MCL1-03      AKDTQPMGRSGATSRKALETLRRVG-------------DGVQRNHETAFQ
A0A2K5I9I0_MCL1-01      AKDTQPMGRSGATSRKALETLRRVG-------------DGVQRNHETAFQ
A0A2K5I9I0_MCL1-02      AKDTQPMGRSGATSRKALETLRRVG-------------DGVQRNHETAFQ
A0A2K5HEJ9_BCL2L2-      ---------EGPAADPLHQAMRAAG-------------DEFETRFRRTFS
A0A2K5HEJ9_BCL2L2-      ---------GPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGC--
A0A2K5KAA3_BCL2A1-      ---------PSKTSRVLQKVAFSVQ-------------EEVEKNLKPCLD
A0A2K5KAA3_BCL2A1-      ---------PSKTSRVLQKVAFSVQ-------------EEVEKNLKPCLD
                                                                .         

A0A2K5HK49_BCL2-01      EMSSQLHLTPFTARGRFATVVEELFRDGV--NWGRIVAFFE--------F
A0A2K5H963_BCL2L1-      SMATH----PGTAYQSFEQVVNELFRDGV--NWGRIVAFFS--------F
A0A2K5H963_BCL2L1-      DLTSQLHITPGTAYQSFEQVVNELFRDGV--NWGRIVAFFS--------F
A0A2K5K3B0_BCL2L10      AYLG----YPGNRVELVALMAEAVLSDSPGPTWGRVVSLVT--------F
A0A2K5HEJ9_BCL2L2-      DLAAQLHVTPGSAQQRFTQVSDELFQGGP--NWGRLVAFFV--------F
A0A2K5I9I0_MCL1-03      GMLRKLDIKNEDDVKSLSRVMIHVFSDGV-TNWGRIVTLIS--------F
A0A2K5I9I0_MCL1-01      GMLRKLDIKNEDDVKSLSRVMIHVFSDGV-TNWGRIVTLIS--------F
A0A2K5I9I0_MCL1-02      GWVCGV-----------------LPCRGP-RRW-----------------
A0A2K5HEJ9_BCL2L2-      DLAAQLHVTPGSAQQRFTQVSDELFQGG--PNWGRLVAFFV--------F
A0A2K5HEJ9_BCL2L2-      ----G---SVNRVTILCDKFSGHPKGFAY-IEFSDKESVRTSLALDESLF
A0A2K5KAA3_BCL2A1-      NVNVA---SIDTARTIFNQVMEKEFEDGI-INWGRIVTIFA--------F
A0A2K5KAA3_BCL2A1-      NVNVA---SIDTARTIFNQVMEKEFEDGI-INWGRIVTIFA--------F
                                                   .    :                 

A0A2K5HK49_BCL2-01      GGVMCVESVNR------------------EMSPLVDN-------------
A0A2K5H963_BCL2L1-      GGALCVESVDK------------------EMQVLVSR-------------
A0A2K5H963_BCL2L1-      GGALCVESVDK------------------EMQVLVSR-------------
A0A2K5K3B0_BCL2L10      AGTLLEREPLVTAWWKKRSFQPRLKEQEGDVARDCQR-------------
A0A2K5HEJ9_BCL2L2-      GAALCAESVNK------------------EMEPLVGQ-------------
A0A2K5I9I0_MCL1-03      GAFVAKHLKTI------------------NQESCIEP-------------
A0A2K5I9I0_MCL1-01      GAFVAKHLKTI------------------NQESCIEP-------------
A0A2K5I9I0_MCL1-02      ------------------------------HQKCAAG-------------
A0A2K5HEJ9_BCL2L2-      GAALCAESVNK------------------EMEPLVGQ-------------
A0A2K5HEJ9_BCL2L2-      RGRQIKVIPKR------------------TNRPGISTTDRGFPRARYRAR
A0A2K5KAA3_BCL2A1-      EGILIKKLLRQ------------------RIAPDVDT-------------
A0A2K5KAA3_BCL2A1-      EGILIKKLLRQ------------------RIAPDVDT-------------
                                                                          

A0A2K5HK49_BCL2-01      -------IALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSM---------
A0A2K5H963_BCL2L1-      -------IATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAA-------
A0A2K5H963_BCL2L1-      -------IATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAA-------
A0A2K5K3B0_BCL2L10      -------LVALLSSRLAGQHRAWLQAQGGWDGFCHFFRTPFPL-------
A0A2K5HEJ9_BCL2L2-      -------VQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLK
A0A2K5I9I0_MCL1-03      -------LAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLE-------
A0A2K5I9I0_MCL1-01      -------LAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLE-------
A0A2K5I9I0_MCL1-02      -------FCRCCWS------RSWF--------------------------
A0A2K5HEJ9_BCL2L2-      -------VQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALE-------
A0A2K5HEJ9_BCL2L2-      TTNYNSSRSRFYSGFNSRPRGRVYRGRARATS------------------
A0A2K5KAA3_BCL2A1-      ----YKEISYFVAEFIMNNTGEWIRQNGGWENGFV---------------
A0A2K5KAA3_BCL2A1-      ----YKEISYFVAEFIMNNTGEWIRQNGGWGK------------------
                                                                          

A0A2K5HK49_BCL2-01      --------------------------------------------------
A0A2K5H963_BCL2L1-      -------------------------------------------------E
A0A2K5H963_BCL2L1-      -------------------------------------------------E
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-01      --------------------------------------------------
A0A2K5I9I0_MCL1-02      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5HK49_BCL2-01      ----------WPLFDFSWLSLKTLLSLALVGACITLGAYLGHK-------
A0A2K5H963_BCL2L1-      SRKGQERFNRWFLTGMT------------VAGVVLLGSLFSRK-------
A0A2K5H963_BCL2L1-      SRKGQERFNRWFLTGMT------------VAGVVLLGSLFSRK-------
A0A2K5K3B0_BCL2L10      --------AFWRKLLIQ------------AFLACLLTTAFGYL-------
A0A2K5HEJ9_BCL2L2-      LEAHFHGCGSVNRVTIL------------CDKFSGHPKGFAYIEFSDKES
A0A2K5I9I0_MCL1-03      --------GGIRNVLLA------------FAGVAGVGAGLAYLIR-----
A0A2K5I9I0_MCL1-01      --------GGIRNVLLA------------FAGVAGVGAGLAYLIR-----
A0A2K5I9I0_MCL1-02      ----------------------------------GISNQIALL-------
A0A2K5HEJ9_BCL2L2-      -EARRLREGNWASVRTV------------LTGAVALGALVTVGAFFASK-
A0A2K5HEJ9_BCL2L2-      ----------WYSPY-----------------------------------
A0A2K5KAA3_BCL2A1-      --KKFEPKSGWMTFLEV------------TGKICEMLSLLKQYC------
A0A2K5KAA3_BCL2A1-      ----------WHNHMPM---------------LVESVAHKKKKMAL----
                                                                          

A0A2K5HK49_BCL2-01      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      VRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNS
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-01      --------------------------------------------------
A0A2K5I9I0_MCL1-02      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5HK49_BCL2-01      -------------------------------
A0A2K5H963_BCL2L1-      -------------------------------
A0A2K5H963_BCL2L1-      -------------------------------
A0A2K5K3B0_BCL2L10      --------------------------WTRLL
A0A2K5HEJ9_BCL2L2-      SRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K5I9I0_MCL1-03      -------------------------------
A0A2K5I9I0_MCL1-01      -------------------------------
A0A2K5I9I0_MCL1-02      -------------------------------
A0A2K5HEJ9_BCL2L2-      -------------------------------
A0A2K5HEJ9_BCL2L2-      -------------------------------
A0A2K5KAA3_BCL2A1-      -------------------------------
A0A2K5KAA3_BCL2A1-      -------------------------------
                                                       

© 1998-2022Legal notice