Dataset for protein BCL-2-like of organism Colobus angolensis palliatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5HEJ9_BCL2L2-      ----------------------------------------------MATP
A0A2K5HEJ9_BCL2L2-      ----------------------------------------------MATP
A0A2K5I9I0_MCL1-03      --------------------------------------MFGLKRNAVIGL
A0A2K5K3B0_BCL2L10      -------------------------------------MADQLRERTNVAD
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5I9I0_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
A0A2K5HK49_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATP--------GA
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENR--------TE
                                                                          

A0A2K5HEJ9_BCL2L2-      ASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAAD------PLH-----
A0A2K5HEJ9_BCL2L2-      ASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAAD------PLH-----
A0A2K5I9I0_MCL1-03      NLYCGGAGLGAGSGGATPPGGRLLATGAKDTQPMGRSGATSRKAL-----
A0A2K5K3B0_BCL2L10      PLRERTERLLADYLGCCAR-----EPGTPEPRPSTPEAAVLRSAA-----
A0A2K5KAA3_BCL2A1-      -------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQ-----
A0A2K5KAA3_BCL2A1-      -------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQ-----
A0A2K5I9I0_MCL1-02      GEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFA
A0A2K5HK49_BCL2-01      APAPGIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAAAAGPALS-----
A0A2K5H963_BCL2L1-      ----------------------MWKRTGLRPQKG----------------
A0A2K5H963_BCL2L1-      APEG---TESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAR-----
                                                                          

A0A2K5HEJ9_BCL2L2-      -----------------------------------------QAMRAAGDE
A0A2K5HEJ9_BCL2L2-      -----------------------------------------QAMRAAGDE
A0A2K5I9I0_MCL1-03      -----------------------------------------ETLRRVGDG
A0A2K5K3B0_BCL2L10      -----------------------------------------ARLRQ----
A0A2K5KAA3_BCL2A1-      -----------------------------------------KVAFSVQEE
A0A2K5KAA3_BCL2A1-      -----------------------------------------KVAFSVQEE
A0A2K5I9I0_MCL1-02      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
A0A2K5HK49_BCL2-01      --------------------------------PVPPV--VHLTLRQAGDD
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------EVIPMAAVKQALREAGDE
                                                                          

A0A2K5HEJ9_BCL2L2-      FETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG--PNWGRLVAFF
A0A2K5HEJ9_BCL2L2-      FETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG--PNWGRLVAFF
A0A2K5I9I0_MCL1-03      VQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGV-TNWGRIVTLI
A0A2K5K3B0_BCL2L10      LHRSFFSAYLGY-------PGNRVELVALMAEAVLSDSPGPTWGRVVSLV
A0A2K5KAA3_BCL2A1-      VEKNLKPCLDNVNVA---SIDTARTIFNQVMEKEFEDGI-INWGRIVTIF
A0A2K5KAA3_BCL2A1-      VEKNLKPCLDNVNVA---SIDTARTIFNQVMEKEFEDGI-INWGRIVTIF
A0A2K5I9I0_MCL1-02      NSSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQ--ATGAKDTQPM
A0A2K5HK49_BCL2-01      FSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDG--VNWGRIVAFF
A0A2K5H963_BCL2L1-      LNRRWRPPVPSMATH----PGTAYQSFEQVVNELFRDG--VNWGRIVAFF
A0A2K5H963_BCL2L1-      FELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDG--VNWGRIVAFF
                                                     :    :      . .. .  .

A0A2K5HEJ9_BCL2L2-      VFGAAL--------------CAESVNKEMEPLVG---QVQEWMVAYLETR
A0A2K5HEJ9_BCL2L2-      VFGAAL--------------CAESVNKEMEPLVG---QVQEWMVAYLETR
A0A2K5I9I0_MCL1-03      SFGAFVAKHLKTIN---QESCIEP------------------LAESITDV
A0A2K5K3B0_BCL2L10      TFAGTLLEREPLVTAWWKKRSFQPRLKEQEGDVA---RDCQRLVALLSSR
A0A2K5KAA3_BCL2A1-      AFEGIL--------------IKKLLRQRIAPDVDTYKEISYFVAEFIMNN
A0A2K5KAA3_BCL2A1-      AFEGIL--------------IKKLLRQRIAPDVDTYKEISYFVAEFIMNN
A0A2K5I9I0_MCL1-02      GRSGAT--------------SRKALET-----LR---RVGDGVQRNHETA
A0A2K5HK49_BCL2-01      EFGGVM--------------CVESVNREMSPLVD---NIALWMTEYLNRH
A0A2K5H963_BCL2L1-      SFGGAL--------------CVESVDKEMQVLVS---RIATWMATYLNDH
A0A2K5H963_BCL2L1-      SFGGAL--------------CVESVDKEMQVLVS---RIATWMATYLNDH
                           .                  :                   :       

A0A2K5HEJ9_BCL2L2-      LA----DWIHSSGGWA-EFTALYGDGALEEARRLRE--------------
A0A2K5HEJ9_BCL2L2-      LA----DWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPP
A0A2K5I9I0_MCL1-03      LVRTKRDWLVKQRGWD----------------------------------
A0A2K5K3B0_BCL2L10      LAGQHRAWLQAQGGWD----------------------------------
A0A2K5KAA3_BCL2A1-      TG----EWIRQNGGWG--------------K-------------------
A0A2K5KAA3_BCL2A1-      TG----EWIRQNGGWE--------------N-------------------
A0A2K5I9I0_MCL1-02      FQ----GWV------------------------------CGVLPCRGPRR
A0A2K5HK49_BCL2-01      LH----TWIQDNGGWD--------------AFVELYGPSM----------
A0A2K5H963_BCL2L1-      LE----PWIQENGGWD--------------TFVELYGNNAAAESRKGQER
A0A2K5H963_BCL2L1-      LE----PWIQENGGWD--------------TFVELYGNNAAAESRKGQER
                               *:                                         

A0A2K5HEJ9_BCL2L2-      -GNWASV------------RTVLTGAVALGALVT----------------
A0A2K5HEJ9_BCL2L2-      PGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVT
A0A2K5I9I0_MCL1-03      ----GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR---------
A0A2K5K3B0_BCL2L10      ----GFCHFFRTPFPLAFWRKLLIQAFLACLLTTAFGYLWTRLL------
A0A2K5KAA3_BCL2A1-      ------------------WHNHMPM---LVESVAHKKKKMAL--------
A0A2K5KAA3_BCL2A1-      -------GFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC----------
A0A2K5I9I0_MCL1-02      WHQKCAAGFC--------------RCCWSRSWFGISNQIALL--------
A0A2K5HK49_BCL2-01      ---WPLFDFSWLSLKTLLSLALVGACITLGAYLGHK--------------
A0A2K5H963_BCL2L1-      FNRWFLTGMT------------VAGVVLLGSLFSRK--------------
A0A2K5H963_BCL2L1-      FNRWFLTGMT------------VAGVVLLGSLFSRK--------------
                                                                          

A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      ILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRP
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5I9I0_MCL1-02      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
                                                                          

A0A2K5HEJ9_BCL2L2-      ----------------------------------------------VGAF
A0A2K5HEJ9_BCL2L2-      GISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSW
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5I9I0_MCL1-02      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
                                                                          

A0A2K5HEJ9_BCL2L2-      FASK
A0A2K5HEJ9_BCL2L2-      YSPY
A0A2K5I9I0_MCL1-03      ----
A0A2K5K3B0_BCL2L10      ----
A0A2K5KAA3_BCL2A1-      ----
A0A2K5KAA3_BCL2A1-      ----
A0A2K5I9I0_MCL1-02      ----
A0A2K5HK49_BCL2-01      ----
A0A2K5H963_BCL2L1-      ----
A0A2K5H963_BCL2L1-      ----
                            

© 1998-2020Legal notice