Dataset for protein BCL-2-like of organism Colobus angolensis palliatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5HEJ9_BCL2L2-      --------------------------MATPASAPDTRALVADFVGYKLRQ
A0A2K5H963_BCL2L1-      -------------------------------MSQSNRELVVDFLSYKLSQ
A0A2K5HK49_BCL2-01      -------------------------MAHAGRTGYDNREIVMKYIHYKLSQ
A0A2K5HEJ9_BCL2L2-      --------------------------MATPASAPDTRALVADFVGYKLRQ
A0A2K5K3B0_BCL2L10      ----------------MADQLRERTNVADPLRERTERLLADYLGCCAR--
A0A2K5I9I0_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGAGSGGATP---PGGRLL-----------
A0A2K5I9I0_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSGGATP---PGGRLLATEKEASARRE
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSK------------------
A0A2K5KAA3_BCL2A1-      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSK------------------
                                                                          

A0A2K5HEJ9_BCL2L2-      KG------------------------------------------------
A0A2K5H963_BCL2L1-      KG------------------------------------------------
A0A2K5HK49_BCL2-01      RG------------------------------------------------
A0A2K5HEJ9_BCL2L2-      KG------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-02      IGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTATPARLL
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5K3B0_BCL2L10      --------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-02      FFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELV
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5HEJ9_BCL2L2-      ------------------------------------YVCGAGPG------
A0A2K5H963_BCL2L1-      ---------YSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDS
A0A2K5HK49_BCL2-01      ---------YEW--------DAGDVGAATPGAAPAPGIFSSQPG-HTPHP
A0A2K5HEJ9_BCL2L2-      ------------------------------------YVCGAGPG------
A0A2K5K3B0_BCL2L10      -----------------------------------------EPGTPEPRP
A0A2K5I9I0_MCL1-03      -----------------------------------------ATGAKDTQP
A0A2K5I9I0_MCL1-02      GESNSSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTQP
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5HEJ9_BCL2L2-      ---EGPAADP-----------------------LHQAMRAAGDEFETRFR
A0A2K5H963_BCL2L1-      PAVNGATGHSSSLDAREVIPMAA----------VKQALREAGDEFELRYR
A0A2K5HK49_BCL2-01      AASRDPVARTSPLPTPAAPAAAAGPALSPVPPVVHLTLRQAGDDFSRRYR
A0A2K5HEJ9_BCL2L2-      ---EGPAADP-----------------------LHQAMRAAGDEFETRFR
A0A2K5K3B0_BCL2L10      STPEAAVLRS-----------------------AAARLRQ----LHRSFF
A0A2K5I9I0_MCL1-03      MGRSGATSRK-----------------------ALETLRRVGDGVQRNHE
A0A2K5I9I0_MCL1-02      MGRSGATSRK-----------------------ALETLRRVGDGVQRNHE
A0A2K5H963_BCL2L1-      ------------------------------------MWKRTGLRPQKGLN
A0A2K5KAA3_BCL2A1-      ---------------------------------TSRVLQKVAFSVQEEVE
A0A2K5KAA3_BCL2A1-      ---------------------------------TSRVLQKVAFSVQEEVE
                                                              .           

A0A2K5HEJ9_BCL2L2-      RTFSDLAAQLHVTP-GSAQQRFTQVSDELFQGGP--NWGRLVAFFVFGAA
A0A2K5H963_BCL2L1-      RAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGV--NWGRIVAFFSFGGA
A0A2K5HK49_BCL2-01      RDFAEMSSQLHLTP-FTARGRFATVVEELFRDGV--NWGRIVAFFEFGGV
A0A2K5HEJ9_BCL2L2-      RTFSDLAAQLHVTP-GSAQQRFTQVSDELFQGGP--NWGRLVAFFVFGAA
A0A2K5K3B0_BCL2L10      SAYLGYPGNR--------VELVALMAEAVLSDSPGPTWGRVVSLVTFAGT
A0A2K5I9I0_MCL1-03      TAFQGMLRKLDIKN-EDDVKSLSRVMIHVFSDGV-TNWGRIVTLISFGAF
A0A2K5I9I0_MCL1-02      TAFQGWVCGV------------------LPCRGP-RRW------------
A0A2K5H963_BCL2L1-      RRWRPPVPSMATHP-GTAYQSFEQVVNELFRDG--VNWGRIVAFFSFGGA
A0A2K5KAA3_BCL2A1-      KNLKPCLDNVNVASIDTARTIFNQVMEKEFEDGI-INWGRIVTIFAFEGI
A0A2K5KAA3_BCL2A1-      KNLKPCLDNVNVASIDTARTIFNQVMEKEFEDGI-INWGRIVTIFAFEGI
                                                        .    *            

A0A2K5HEJ9_BCL2L2-      LCAESVNKEM------------------EPLVG---QVQEWMVAYLETRL
A0A2K5H963_BCL2L1-      LCVESVDKEM------------------QVLVS---RIATWMATYLNDHL
A0A2K5HK49_BCL2-01      MCVESVNREM------------------SPLVD---NIALWMTEYLNRHL
A0A2K5HEJ9_BCL2L2-      LCAESVNKEM------------------EPLVG---QVQEWMVAYLETRL
A0A2K5K3B0_BCL2L10      LLEREPLVTAWWKKRSFQPRLKEQEGDVARDCQ---RLVALLSSRLAGQH
A0A2K5I9I0_MCL1-03      VAKHLKTINQ------------------ESCIE---PLAESITDVLVRTK
A0A2K5I9I0_MCL1-02      ---------H------------------QKCAA---GFCRCCWS------
A0A2K5H963_BCL2L1-      LCVESVDKEM------------------QVLVS---RIATWMATYLNDHL
A0A2K5KAA3_BCL2A1-      LIKKLLRQRI------------------APDVDTYKEISYFVAEFIMNNT
A0A2K5KAA3_BCL2A1-      LIKKLLRQRI------------------APDVDTYKEISYFVAEFIMNNT
                                                             .            

A0A2K5HEJ9_BCL2L2-      ADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAG
A0A2K5H963_BCL2L1-      EPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMT---------
A0A2K5HK49_BCL2-01      HTWIQDNGGWDAFVELYGPSM-------------WPLFDFS---------
A0A2K5HEJ9_BCL2L2-      ADWIHSSGGWAEFTALYGDGALEEAR--------RLREGNW---------
A0A2K5K3B0_BCL2L10      RAWLQAQGGWDGFCHFFRTPFPL---------------------------
A0A2K5I9I0_MCL1-03      RDWLVKQRGWDGFVEFFHVEDLE---------------------------
A0A2K5I9I0_MCL1-02      RSWF----------------------------------------------
A0A2K5H963_BCL2L1-      EPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMT---------
A0A2K5KAA3_BCL2A1-      GEWIRQNGGWG--------K-----------WHNHMPM------------
A0A2K5KAA3_BCL2A1-      GEWIRQNGGWE--------NGFVKKFEPKSGWMTFLEVTGK---------
                          *:                                              

A0A2K5HEJ9_BCL2L2-      PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDK
A0A2K5H963_BCL2L1-      ------------------------------------VAGVVLLGSLFSRK
A0A2K5HK49_BCL2-01      ------------------------WLSLKTLLSLALVGACITLGAYLGHK
A0A2K5HEJ9_BCL2L2-      ------------------------ASVRTVLTGAVALGALVTVGAFFASK
A0A2K5K3B0_BCL2L10      ------------------------AFWRKLLIQAFLACLLTTAFGYLWTR
A0A2K5I9I0_MCL1-03      ------------------------GGIRNVLLAFAGVAGVGAGLAYLIR-
A0A2K5I9I0_MCL1-02      --------------------------------------GISNQIALL---
A0A2K5H963_BCL2L1-      ------------------------------------VAGVVLLGSLFSRK
A0A2K5KAA3_BCL2A1-      ------------------------------------LVESVAHKKKKMAL
A0A2K5KAA3_BCL2A1-      ------------------------------------ICEMLSLLKQYC--
                                                                          

A0A2K5HEJ9_BCL2L2-      FSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTT
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
A0A2K5HEJ9_BCL2L2-      --------------------------------------------------
A0A2K5K3B0_BCL2L10      LL------------------------------------------------
A0A2K5I9I0_MCL1-03      --------------------------------------------------
A0A2K5I9I0_MCL1-02      --------------------------------------------------
A0A2K5H963_BCL2L1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
A0A2K5KAA3_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5HEJ9_BCL2L2-      DRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K5H963_BCL2L1-      -------------------------------------------------
A0A2K5HK49_BCL2-01      -------------------------------------------------
A0A2K5HEJ9_BCL2L2-      -------------------------------------------------
A0A2K5K3B0_BCL2L10      -------------------------------------------------
A0A2K5I9I0_MCL1-03      -------------------------------------------------
A0A2K5I9I0_MCL1-02      -------------------------------------------------
A0A2K5H963_BCL2L1-      -------------------------------------------------
A0A2K5KAA3_BCL2A1-      -------------------------------------------------
A0A2K5KAA3_BCL2A1-      -------------------------------------------------
                                                                         

© 1998-2020Legal notice