Dataset for protein BCL-2-like of organism Colobus angolensis palliatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------a-a----mlvagfggyyar--dyvqyvgpp
mfhlkrtsysnrelvvkylsyklsqrgytwsqgsvvattrqlsrrtmitp-s-pgtrgtscd-vpikrlqq--lcralqi
 agag ngviglniymggihlgagsk asppgfrllemnpgarenrvaglppygdvia-d-eyty-al-gkgswagttsg
      maqd     cdfag     g  e da ddg emke ka anvagnlretif-s-p-s--s--parrp-rvgslr
                                     aef      e  egeecrgetgqemhs ptpntppmrkt rkl
                                      ad         d      asel  el hpiasn l hp d e
                                                 a       r g  a  cc   g a el a d
                                                                 a              
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pqpgap---tsrplr----------------------------------------------qalrsvgdeferrfrrafs
egnasgpsa---vaqllffaptrraapleemeapaadaimspeeeldgyepepvppvpavlkvmfqa-e-vstnykptlp
tvks-dsakvlt--h                                     elikra  k-ta-a-q-slqkslftcyd
atgmt-ghvsgps -                                       g m   hp--e-   gnns wessvq
 r  gvegsaalk s                                              lr  r   d hl tdgp l
 i  etad    d l                                              el  l        h  d a
     r      a a                                              a   e              
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   :    :      . .. .  .   .                  :                 
dmavql--tpgtayqsftqvveelfrdg--vnWGRiVaffsFggal--------------cvesvnkemeplvd---ria
slnsa-hv-idsrrtrvntmmnkvlsgsigptgaklttlvvreaivlkrlptvtawwqksskkplrq----d-stykqvs
nv-a-aeisnfnlvriserisdre qeqv i    v sima s vtaeheklin   keriaql-d-riqv-lg   e-q
gyt-p dlkeeedqkqlal ishy e  p t    d qpit a tm               r ar-t qag  -   -d-
etstk  ee  d  gl se aia       a         g   f                i   lr  s   r   n g
  prh         e  l                      e                    f   e       a     c
  lp                                                                            
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :              *:                                                             
ywmaeylntrla----dWiqsngGWd--------------------------------------glvgf----------r
tfvvafiedhtgrtkrp lrqs---eleftklyvrgmleeafvelygnnaaaesrkgqerfnrw----mtwvelpeagw-
e-lttshmnnfegqh e vheqr  -  aiaargdeae  trrlrelqsmvvlqmrmsrpwgnkffti-srtskmtslsm
-r qrn tsv v    t  ---   g              nek k  p egekpcn pp phqapsfh fklpflllfil
qg   l sra q    g  vk    a              k        c              cpce vikfekkgdah
         h    a   d                                           aaad che d      
                  a                                                           
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--lagvvllgslfsrk----------------------------------------------------------------
tvv-ac--ycayvthlkylwtlllsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrp
nl-vvaiwvvewlg--nqymrrcg                                                        
siytr-gtsrlvtalsgkkilg                                                          
khmpqtfkiagtgeifeaifh                                                           
af lmncga  sa g a hca                                                           
   i fad   m  e    a                                                            
   g   a      a                                                                 
   e                                                                            

       410       420       430       440       450    
....:....|....:....|....:....|....:....|....:....|....
                                                      
------------------------------------------------------
gisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrgrarvtswyssy
                                              agaffapk
                                                      
                                                      
                                                      
                                                      
                                                      
                                                      
© 1998-2020Legal notice