Dataset for protein BCL-2-like of organism Colobus angolensis palliatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------r-lvadylgyklr--------------gpgegsgg--------------------------
mmfqlrrrtmmtdceapdt-r------qfv-sqkgyiwlnlyvggaslqpapapgiftsspmhtpspinsrpswkrtssr
 adg kenmvaapasfgynyeiaqkfvm-gpqrnavvgtgtsdvrpi-pa-a-a   seqege  haaagndpvhlvgpp
        anvmlrlyesika qvgvi-q-nkgrrlsesagpctqe-t-- -v-                  m a  dll
         aiggptsyrleg lnesgscta- g  lcpqfkepe trts nts                          
          h enmrqkga  gm  ekam p    eag ad ca ngr   el                          
             e gcg         h c m      d       m                                 
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------pvhqrlraagdefs-------------rrferafsgmltqlhvtpgtavqsf-qvv-el
pvpgatghssspdlspvppatktsramqkve--vqsiyvgnvdygataeeyrktlkela------sidtyrr-t---n--
atna paaaaglaare i vs-pggv-lq--ksae             tsvfinggdc-svvnisavssqp-lfnqsmhv
 qk                mrvl--te--tafdlr             anr tgyqpagdnigganfnrpttietmmegk
                    dsams- erm ag n             l w spvpsytak dlk eadaklvarkfdah
                    pa-lli  e     h               l ph l  srh   g    rgi sl as  
                    a ike                         h ad h              e  cd  i  
                       aa                              a                        
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                           .                                                    
frdgv--nwgrivaffs--------fggalckes-------vrkemqplvg---------------------iaewmaey
--g-pii------t---slaldesl--aivivklptvtawwrnrrievpisttergvprdryrarttnyyke-s-f---f
es-d-yttfsdle-lvv         e vqtpdaklin   lkvarp d-drqdgdfa a         nssv-y-vvt-
pqesggpe   v sirt         r tmlavi       qdqtna -l-q                 cqrlqtsytav
lf fa      k  via         a r aere       pessfs r kn                    rvrllssr
 k              e           f   h        k  c r g  e                      l i g 
                                                                          a   d 
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
lnrhlgdwiqtnggwdt---------------------------------------------------------------
--trvrpvtrssarllgfvptrraapleemeapaadaimspeeeldgyepeplgkrpavlpllelvgesnssstdgslps
imnntpe lhqqr aefgavkkfvrkm     eklkelqnev kqmnms p gnag vimsie kmeadar iyv nvdy
nederet yaep   tsefi a epe                                                      
 vatkar  vkr   gn                                                               
 sgqhha   g    al                                                               
 a p      d     k                                                               
          a     e                                                               
                a                                                               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
tpppaeeeedelygcgsvqsleiisrylreqatgakdtqpmnrsgatsrkaletlrrvgdgvqrnhetafqgwvrkvdik
g at   l ahfhr    nrvt lcdkfsghpk fayiefsgnaavetslgqdrf            sl r rqigl   
                                         psms r                         mlc     
                                         dke                                    
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                  :             
------------------------------------------------------------------wflfy---------
nedivkstsrvmisvtsrgvtrwryrvtttsynssvsrhystinsrscirvyrrsiwsvlvrtkrsfystgrtwlslvtr
   dp rln pg htpdd prnagriarlinfgafrakflkgf qqprgeplcgrctd      nr v-pfmsgdlfkel
              lfc  fp                       hek aagfaecara      tg tv--pg ageeaf
                                                                sd ptlqhd       
                                                                   mnkmg        
                                                                   lhhlf        
                                                                   he de        
                                                                   ca           

       490       500       510     
....:....|....:....|....:....|....:
                                   
-------g-----------------g---------
rsvegvl-girnvllqfagvagvtl-saylrkrll
llttdleaewvtlkkaavalgvlltvllfsirk  
fhrplpavsvlsh tkymlacligaqiylgwt   
  mafnwcfs k  igkf   c vnagg fhs   
  l  ki  m a     c   a s  f   a    
      g                   a        
                                   
                                   
© 1998-2022Legal notice