Dataset for protein BCL-2-like of organism Colobus angolensis palliatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------mfrllvndvigykly--g-gpgagsg---------------------------------------------
mmmtpceapd-gekr-ayl-ln--qk-y-l-p---gatppggrllatekeasarreigggeagtviggsagasppaaltp
 aamdasfg-t----q-f-q--nscg av-q-fpv                                             
  hagrtsyynyriaak-vsqv r r  swsq nd                                             
    eemgqsika qve ek m q    icp  da                                             
        ekl    m   h   m    e d                                                 
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
darrvarpppigaevpdvtatparllffaptrraapleemeapaadaimspeeeldgyepeplgkrpavlpllelvgesn
                                                                             vee
                                                                             gaa
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------egptsrpllqtlrsag-------------de
ssstdpslpstpppaeetedelyrqslwirtrylreqatgakdtqpmgrsvapm-kahkvmfrvqsiyvgnvdygataeg
trteagepgiftsspqlepstnvsrpsekisssrpvpgatghasslgtspskaad-vqeaa-a--             --
npga  ag   smqemhr rpingndpvhlvgrpltnylpccsrg dlp-p---tve----a- r             ar
            eadg   haaaad mre  ep aqk    a ae aa g-vivsi-klme q a              d
                            a  dl  ad              r  aa ea   e                 
                                                   i     a    d                 
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.                                    .    :                                     
verrhrrafsgmlvql--tpgtavqsftqvmeelfsdgv--nWgrivaffs--------Fggalckesvnk---------
fqtnfetclqdlask-hisnesdrtrlsr-vnhvprgspgitf--l-tlivslaldesl-eaivivklptrtawwkkrsf
lsklykpt-dnvnrgvdv-idd-ykl-n-msikelqrai tr sd-esi-t         --f-aah-lrq         
 rqhlhspv----aa  lk---vq-ivetf-d-pkef - pe   v --va         r -q---ikdi         
 nl w gf psyv--   yvnrr-i-cal a-a  g  y r    k  vr-         a vmleve---         
  a    d aewtth     fn tg  -k  g   c              e           t   r  lv         
          a sg          e  d                                  r      k          
             c                                                                  
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------emeplvst--------------------iaewmaeylnrhlrdWiqsnggwdgfve---------------
qprlkeqegrqqvdidrtdrgfpraryrarttnyykelsyfvttfivtttgpvlrqqr--et---lygvnaleeeaeklk
         niasccgq                 nssvqtsivsv-mnrkee yvks-ra--gtvffrnedaa       
         -vsrgaep                    rvrlysd-nedn-at fhe-a  tsefikahtsmpl       
         tnrk  qn                    fclclwar ---rhs  --r   gn ch   prfm        
         dh    ag                      a c g  sgqh r   g    al aa   dpe         
                                              a p  a   d     k       g          
                                                       a     e                  
                                                             a                  

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------wrnvl---------------
elqnevekqmnmspppgnagpvimsieekmeadarsiyvgnvdygataeesrkgqerfggifltgmvwlslktllslalv
                                                  learflpknr--sf-lt            f
                                                     krhgessvy--yia            t
                                                     h   can ptptts            l
                                                           f nrlrpq            c
                                                             mkhmfm            a
                                                             h  del             
                                                             a                  

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
agvvglgallayl-------------------------------------------------------------------
----lv-sgfsrkirsdsksvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfn
gkace-v---k--mflake                                                             
tlla-sttyvgvyeaf                                                                
faistmsnqk-qic                                                                  
d fiaipkhitlga                                                                  
  c  hl a  k                                                                    
           h                                                                    
                                                                                

       570       580 
....:....|....:....|.
                     
---------------------
srprgrvyrgraratswyspy
                 trll
                     
                     
                     
                     
                     
                     
© 1998-2022Legal notice