Dataset for protein BCL-2-like of organism Colobus angolensis palliatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------gatp---p--r-l-----------------------------------------
mtglkrnyvyrlnqyylqyvlqipsp----ssa-dt-l-vadfvgyklrqkgggeagtviggsagasppaaltpdarrva
 fdcefgaiig aldcggag gagqgmsggaksygn eiavyylssarser                             
                madq rertnvhd rtgrtg a  tklihc    i                             
                         ma a lreqse    mekgc                                   
                               m        d  ea                                   
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
rpppigaevpdvtatparllffaptrraapleemeapaadaimspeeeldgyepeplgkrpavlpllelvgesnssstdy
                                                                               g
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                              . 
--------------------------------pg----------ga--r------------------------ahqtlrr
swsstspveenrtdvpyrtssemptpyvcgag--akdtqpmgre--ta-ssslptrevppmaagpalspvppvvsramqq
elpqfpdpa eegeelegqplaiisrslrssatswhtprssavsdpvsdp p dapaaiaa            tlevwkk
          dae agaa eg aea giinqq  tplvh ptsra alhk                       l--r  a
                           afegn    e d a pn   g t                       -klm  e
                               e                                          aa    
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                          .    *                                
vgdevqrrfrrafspllsqlhvtp-gtarqsftqvveelfrdGp--nWGRiVaffsFggalcvesvnkem----------
aafsfetnyettlqgmvdnv----i---ytr-n--mnkvpsgsvgit --l-tl-v-eai-ikkllrqriwwkkrsfqpr
---gpseevnknykdcaasrnias dsdv-ivetmsd-elqr i vr   - -iva ---v-a---d--q          
t l-lhlshfsrwreytrkmdtkn fd qk-lar --h  e  - t    v s-i- a vml-rep-vth          
   r  kgl  d l wspg alh  e  -gl -l aia  c    r         t   t aeh ktrna          
   d         a ppg           e  s            p         e   f      li            
                 c                                                              
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 .              *:                                              
--------qplvd---riaewmaeylnthlrdWiqsngGWd-fvelyg-na-----------------------------
lkeqegdvevdistykqvsyfvvtfimrrtgp lrqs---et------v--leesrkgqerwnrwlltgmtmspppgnag
        asccg   elqtslts--enn-ee fheqr  -getiffrnsmaakkfeplsgfqnrfevtnw         
        sr aq   pfvrliwav -d-kat  ---   gl chkahtrgpv ea kkkelmthvrmqgs         
         k  e   n clccsdr v-thhs  vk    ae aa   ppfml a       h fppkdfn         
            a   g  a      agq  a   d     a      dkef            em f  k         
                                   a             gd                e            
                                                 e                              

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------vcgvvtlgaylsrk------------------------------
pvimsieekmeadarsiyvgnvdygswrkvllaafllaestnvlslfc--lsghpkgfayiefsdkesvrtslaldeslf
                        alvltt tslah-galslrvkqy-trfl                            
                        wgtanl iqhvgi-lmlaqktkkwsl                              
                         fs ee egf agv iishigi mh                               
                         ai         a  cg gf f id                               
                                          a    ga                               
                                               a                                

       490       500       510       520       530       540         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
                                                                     
---------------------------------------------------------------------
rgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrgraratswyspy
                                                                     
                                                                     
                                                                     
                                                                     
                                                                     
                                                                     
© 1998-2020Legal notice